KEGG   Anolis carolinensis (green anole): 100567445Help
Entry
100567445         CDS       T01608                                 

Gene name
prkaa1
Definition
protein kinase, AMP-activated, alpha 1 catalytic subunit
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100567445 (prkaa1)
   04150 mTOR signaling pathway
    100567445 (prkaa1)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100567445 (prkaa1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100567445 (prkaa1)
   04920 Adipocytokine signaling pathway
    100567445 (prkaa1)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100567445 (prkaa1)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100567445 (prkaa1)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100567445 (prkaa1)
  Mitophagy factors
   Other mitophagy factors
    100567445 (prkaa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 550 aa AA seqDB search
MAAADKQKHEHGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDV
VGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESR
RLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSP
NYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYL
NPAVISLLKHMLQVDPMKRATIRDIREHDWFKLDLPKYLFPEDPSYSSTMIDDEALKEVC
EKFECTEEEVLGCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHFSR
PHPERVPFLVAELPRQRHTLDELNPQKSKHQGVRRAKWHLGIRSQSRPNDIMAEVCRAIK
QLDYEWKVVNPYYLRVRRKNPVTGTYSKMSLQLYQVDSRTYLLDFRSIDDEINEVKSGTA
TPQRSGSVTNYKSCQKDSDTDAQGRSSDMSLTSSVTSSLDSSSAELTPRSGSHTIEFFEM
CANLIKILAQ
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggataaacagaaacatgagcacgggcgggtgaagatcgggcactacatc
ttgggggacacgctgggcgtgggcaccttcggcaaagtcaaggttggcaagcatgagctg
actgggcacaaagtagcggttaagatcttgaacagacagaagattcgcagtcttgacgtc
gtgggtaaaatccgcagagaaattcagaatctgaagctttttcggcatccacacataatt
aagctgtaccaggttatcagcacaccctctgacattttcatggttatggaatatgtttca
ggaggtgaattgtttgattacatctgtaaaaatggaaggcttgacgaaaaggagagtaga
cgcctcttccagcaaatcctttcaggtgtggattattgccataggcacatggtagttcac
agagacttgaaacctgaaaatgtactactcgatgcacacatgaatgccaagattgctgat
tttggcctttcaaatatgatgtcagatggagaatttttgagaacaagctgtggctctcct
aattatgctgctccagaagtaatttccggaagattatatgcaggcccagaagtggatatc
tggagcagtggagttattctttatgctctgttatgtgggacccttccgtttgacgatgat
catgtgccaacactttttaagaaaatatgtgatggtatattttatactcctcagtacctg
aatccagcagtaattagccttttgaaacacatgctgcaggtggatcctatgaagagagct
acaataagagatataagggaacatgactggttcaagctcgacctccccaagtacctcttt
cctgaagacccatcgtacagttcaaccatgattgatgatgaagccttaaaagaggtctgt
gagaagtttgaatgcacagaggaggaagtacttggctgcttgtataatcgaaatcatcag
gatcctttagccgttgcctaccacttgattatagataacaggagaataatgaatgaagct
aaagacttttacttggcaacaagcccaccagattcctttcttgacgatcacttctcccgc
ccccaccccgaaagagtgccatttttagttgctgaattaccaaggcagcggcatacgctt
gatgagctaaacccacagaagtccaaacaccaaggagtcagaagagcaaagtggcatttg
ggaattcggagtcagagtcgaccaaatgacataatggcagaagtttgtcgagcaatcaaa
cagttggattatgaatggaaggttgtaaatccatactatttgcgtgttcgaaggaagaat
ccagtgactggcacttattccaaaatgagtctacagttataccaggtggacagtagaact
tatctattggatttccgtagcattgatgatgaaattaatgaagtcaaatctgggactgcc
actccccagaggtcaggctctgtgacaaactacaaatcttgtcagaaagattcggacact
gatgctcaaggaagatcctctgatatgtctcttacctcctctgtgacctcttccctcgac
tcatcttcagctgagttgaccccaagatcagggagccacacaatagaattttttgaaatg
tgtgcgaatcttattaaaatacttgcgcaatga

DBGET integrated database retrieval system