KEGG   Anolis carolinensis (green anole): 100567479Help
Entry
100567479         CDS       T01608                                 

Gene name
mapk13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Cellular senescence
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
AGE-RAGE signaling pathway in diabetic complications
Salmonella infection
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100567479 (mapk13)
   04370 VEGF signaling pathway
    100567479 (mapk13)
   04068 FoxO signaling pathway
    100567479 (mapk13)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100567479 (mapk13)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100567479 (mapk13)
   04621 NOD-like receptor signaling pathway
    100567479 (mapk13)
   04622 RIG-I-like receptor signaling pathway
    100567479 (mapk13)
  Endocrine system
   04912 GnRH signaling pathway
    100567479 (mapk13)
   04914 Progesterone-mediated oocyte maturation
    100567479 (mapk13)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100567479 (mapk13)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100567479 (mapk13)
  Infectious diseases
   05132 Salmonella infection
    100567479 (mapk13)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100567479 (mapk13)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100567479 (mapk13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 365 aa AA seqDB search
MSFSRRRGFYKQEVNKIVWELPRRYTSIVSVGSGAYGSVCSSIDKKTGEKVAIKKLCRPF
QSEIFAKRAYRELTLLKHMQHENVIGLLDVFTSATSFEGFQDFYLVMPYMQTDLQKIMGH
QFSEEKIQYLIYQVLKGLKYIHSAGIIHRDLKPGNLAVNEDCALKILDFGLARHTDTEMT
GYVVTRWYRAPEVILNWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTLILKVTG
SPGEEFIQKLEDKAAKSYIQTMPKIPKMDLSRLFPRASPLAVDLLDKMLQLDVEKRLTAT
QALAHPYFEPFRDVEEETEAQHSYDDSVGAQKLSINEWRRHIYNEILTFSPIARKDSKRR
SGMTL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcttctccaggagaaggggcttctacaagcaggaagtaaacaagatagtctgggaa
cttcctaggcgatacacgtccattgtctccgtgggatctggagcttatggatcggtctgt
tcatcaatagacaagaaaacaggggagaaagtggctatcaagaagctttgccgcccattt
cagtctgagatctttgctaagcgagcctatcgagaactcacactgctgaagcacatgcag
catgagaatgtcattgggttacttgatgttttcacatcagctacttccttcgaaggattc
caggatttctatttggtgatgccttacatgcaaacagatttacagaagataatgggacat
cagttcagtgaggaaaagatccagtatctgatttaccaggtgttgaaaggtctgaagtat
attcattctgctggaatcattcacagggatctaaagcccggcaatttagcagtgaatgag
gactgtgcactaaagatcttggactttggcctggcaaggcatacagatactgagatgact
ggttatgtggtgactcgttggtacagagcaccagaagtaattctcaattggatgcattac
aatcagactgtggacatctggtcagttggctgcatcatggcagaaatgctgacaggaaaa
actctgtttaaagggaaagactatcttgatcagctgactctgatcttgaaagtaacaggg
agccctggagaggaatttatacagaaactagaagacaaagcggccaaaagctacatacag
acgatgcccaagattcccaaaatggatttgtcccgacttttccccagagctagtcctctt
gcagtggacttgcttgacaaaatgttgcagctggatgtggagaagcgtcttacagccaca
caagctctggctcatccatattttgaaccatttagagatgttgaggaagagacagaggcg
cagcattcctatgatgactcagttggggcacaaaaactttcaatcaatgaatggagaaga
catatttacaatgaaatactaacattcagcccaattgcacggaaagactccaagaggagg
agtggtatgacgctgtaa

DBGET integrated database retrieval system