KEGG   Anolis carolinensis (green anole): 100567522Help
Entry
100567522         CDS       T01608                                 

Definition
cytochrome P450 2J2-like
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100567522
   00591 Linoleic acid metabolism
    100567522
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100567522
Cytochrome P450 [BR:acs00199]
 Cytochrome P450, animal type
  CYP2 family
   100567522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 496 aa AA seqDB search
MLFHCFAVFWETLSLKAVLVFLATFLIVADYVRRIHSRGFPPGPMPLPFVGNLLHLDAEK
PHFSTQKLADIYGNVFSLQLGNRHFVFVNGLEIVKEVLIHHGENFLDRPKFPIISDHAKT
LGLVMSNGLPWKQQRRFALSTLRNFGLGKRSLEERIQEESRFLAGAIENEKGQPFDPHYQ
INNAVSNVICSITFGNRFDYHDSQFQKLLHLLNETGIIQRSIWAQLYNIFPALMKQLPGP
HQTIFKNWEQLKYFVRTIIKKHQENRNPLETRDFIDAYLNEMTKENVSSSFHMENLLQSA
LDLFIAGTETTSTTLRWALLYMAIYPEIQERVQSEIDSVIGQSRPPAMTDRDNLPYTNAV
IHEIQRISNILPLNVPRLTTNNTEIAGFHLPKGTILICNLTSVLFDKDEWDTPKKFNPNH
FLSNGQFRIREAFVPFSAGKRACLGERLARMELFLFFTALIQKFSFQAPKGVELSLDFKM
SLTLSPNQYHICAVSR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgttgttccactgctttgctgtcttttgggagactttatcactgaaggctgttcttgtt
ttccttgctacatttcttattgttgctgactatgtaagacggatacattcaaggggcttc
ccaccagggcccatgcctcttccttttgtgggtaatctacttcatcttgatgctgagaag
cctcatttctctacacaaaagcttgcagacatatatggcaatgtcttcagcttgcagtta
ggaaaccgtcactttgtatttgtaaatggactagaaattgtgaaggaagttcttatccat
catggtgaaaactttctagatcgaccaaaattccctattatatctgaccatgctaagact
ttagggttggtcatgtctaatggacttccctggaaacaacaaagacgatttgccttgtca
acactaagaaactttggtttgggcaaaaggagtttagaagaacgaatacaggaagagagc
aggttccttgcaggtgctattgaaaacgagaaaggacagccatttgacccccactatcaa
attaacaatgctgtttcaaatgtaatttgttccatcacttttggaaaccgctttgattac
catgacagccagttccagaaattgttgcatttgcttaatgaaacaggaatcatccagcga
agtatttgggcccagctgtacaatatttttccagctctcatgaagcaattgccaggaccc
catcaaactattttcaaaaactgggaacaattgaaatactttgtgagaacaataatcaaa
aagcaccaagaaaacaggaatccacttgaaacaagagatttcatcgatgcttacttaaat
gaaatgaccaaggagaatgtttcttccagtttccatatggaaaatctcctgcagtcagca
ctagatttgtttattgctggaacagaaacaacttctacaaccttgcgctgggctttgctg
tacatggctatttatccagaaattcaggaaagagttcagtcagaaatagactctgtgatt
ggccagtctcgccccccagctatgactgacagggacaatctgccttacacgaatgcagtt
attcatgaaattcaaagaataagtaacatcctgcctttaaatgttcctcgactgacaact
aataatacagagatagctgggtttcatctgcccaagggaactattttaatctgcaatctg
acatcagtgttgtttgacaaagatgaatgggacaccccaaaaaaatttaatcccaatcat
ttcttgagtaatggtcaattcaggattagggaagccttcgtaccattctctgcaggaaag
agagcctgtcttggagaacggttggctaggatggaacttttccttttcttcactgctttg
attcagaagttctctttccaggctccaaaaggtgtggagctaagtctcgacttcaagatg
agccttacactgagcccaaaccaataccatatatgtgccgtctcacgttaa

DBGET integrated database retrieval system