KEGG   Anolis carolinensis (green anole): 100567602Help
Entry
100567602         CDS       T01608                                 

Definition
phosphoglycerate mutase 2-like
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:acs01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:acs01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:acs00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:acs00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 254 aa AA seqDB search
MPTHRLVIVRHGESTWNQENRFCGWFDAELSEKGQEEAKRGAQAVKDAGYEFDICYTSVL
KRAIRTLWYIMDGIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSYD
IPPPPMDENHPYYQIISKARRYAALKSGELPSCESLKDTIARALPFWNDEIAPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSDAAIMELNLPTGIPIVYELDDNLKPTKPMQFLGDEETVR
KAMEAVAAQGKVKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgccaacccaccggcttgtgattgtgaggcatggagagagcacctggaaccaggagaac
cgtttctgtggctggtttgatgccgagctgagcgagaaagggcaggaggaagccaagcgc
ggggcccaggctgtcaaggatgctggctacgagttcgacatctgctacacatccgtgctc
aaaagggccatccgcactctgtggtacatcatggatggcattgaccagatgtggctgccc
gtggtgcgcacctggcgcctcaacgagcgccactatgggggcctgaccggactcaacaag
gccgagacggcagccaagcacggggaagaacaggtgaagatctggaggcgttcctatgac
atcccaccgccccccatggatgaaaaccacccttactatcaaatcatcagcaaggcccga
cgttatgctgctttgaaatctggagaactgccttcttgtgagagcctcaaggataccatt
gctcgtgccttgcccttttggaatgatgagattgctccccagatcaaagccggcaagaga
gtattaattgctgcccatggcaacagccttcgagggattgtcaagcacttagaagggatg
tctgatgcagccatcatggaactcaaccttccaactgggattcccatcgtgtatgaattg
gacgacaacctgaaacctacgaagcccatgcagttcctgggtgacgaagaaaccgtaagg
aaggccatggaagctgtggcagcccagggcaaggtcaagaagtga

DBGET integrated database retrieval system