KEGG   Anolis carolinensis (green anole): 100567602Help
Entry
100567602         CDS       T01608                                 

Gene name
pgam2
Definition
(RefSeq) phosphoglycerate mutase 2
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00010  Glycolysis / Gluconeogenesis
acs00260  Glycine, serine and threonine metabolism
acs01100  Metabolic pathways
acs01200  Carbon metabolism
acs01230  Biosynthesis of amino acids
Module
acs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
acs_M00002  Glycolysis, core module involving three-carbon compounds
acs_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100567602 (pgam2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100567602 (pgam2)
Enzymes [BR:acs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100567602 (pgam2)
Membrane trafficking [BR:acs04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100567602 (pgam2)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100567602 (pgam2)
  Exosomal proteins of melanoma cells
   100567602 (pgam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1 KRTDAP
Motif
Other DBs
NCBI-GeneID: 100567602
NCBI-ProteinID: XP_003224246
Ensembl: ENSACAG00000002010
Position
Un
AA seq 280 aa AA seqDB search
MEMFMSSTETNDYRVFVLSATNAPRKMPTHRLVIVRHGESTWNQENRFCGWFDAELSEKG
QEEAKRGAQAVKDAGYEFDICYTSVLKRAIRTLWYIMDGIDQMWLPVVRTWRLNERHYGG
LTGLNKAETAAKHGEEQVKIWRRSYDIPPPPMDENHPYYQIISKARRYAALKSGELPSCE
SLKDTIARALPFWNDEIAPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDAAIMELNLPTGI
PIVYELDDNLKPTKPMQFLGDEETVRKAMEAVAAQGKVKK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggagatgttcatgtcatctacggaaaccaacgattatcgtgtctttgttttgagcgca
acaaatgctccaagaaaaatgccaacccaccggcttgtgattgtgaggcatggagagagc
acctggaaccaggagaaccgtttctgtggctggtttgatgccgagctgagcgagaaaggg
caggaggaagccaagcgcggggcccaggctgtcaaggatgctggctacgagttcgacatc
tgctacacatccgtgctcaaaagggccatccgcactctgtggtacatcatggatggcatt
gaccagatgtggctgcccgtggtgcgcacctggcgcctcaacgagcgccactatgggggc
ctgaccggactcaacaaggccgagacggcagccaagcacggggaagaacaggtgaagatc
tggaggcgttcctatgacatcccaccgccccccatggatgaaaaccacccttactatcaa
atcatcagcaaggcccgacgttatgctgctttgaaatctggagaactgccttcttgtgag
agcctcaaggataccattgctcgtgccttgcccttttggaatgatgagattgctccccag
atcaaagccggcaagagagtattaattgctgcccatggcaacagccttcgagggattgtc
aagcacttagaagggatgtctgatgcagccatcatggaactcaaccttccaactgggatt
cccatcgtgtatgaattggacgacaacctgaaacctacgaagcccatgcagttcctgggt
gacgaagaaaccgtaaggaaggccatggaagctgtggcagcccagggcaaggtcaagaag
tga

DBGET integrated database retrieval system