KEGG   Anolis carolinensis (green anole): 100567651Help
Entry
100567651         CDS       T01608                                 

Definition
succinate-semialdehyde dehydrogenase, mitochondrial-like
Orthology
K00139  
succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Alanine, aspartate and glutamate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100567651
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100567651
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     100567651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 519 aa AA seqDB search
MAKASLVRSFPGFLMQSAGALGAQRRPLCCSSGLGPVSPALLRSGAFVRGRWLQAGASFP
VRDPGSGAELGRVADCGAEEAQAAVKAAYEAGPAWSKATAKERSTLLRKWYDLMIENKDD
LARIITAENGKPLKEAQGEILYSASFLEWFAEEARRVYGDIIPSSAKDRRFLVLKQPVGV
AAIITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPLSALALAELANQAGIPAGVYNVV
PCSRQQAPAVGEVLCTDPLVSKISFTGSTATGKILLRHAAGTVKRVSMELGGHAPFIVFD
SADVDKAVTGALMSKYRNSGQTCVCTNRFLVQKGIHDAFVEKFAEVIKRELHVGYGFDEG
TTQGPLINEKAVEKVENHIHDAVSHGASIVTGGKRHSYGKNFFEPTLLSNVTTSMLCTQE
ETFGPLAPVIKFDTEEEALAIANSTNVGLAGYFYSRDPAQIWRVAEQLEVGMVGINEGLL
SSVECPFGGVKQSGLGREGSKYGIDEYLEIKYVCFGGLQ
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcctccttggttcgctccttcccgggcttcctgatgcagtctgcgggcgcc
ctcggggcccagcgccgcccgctctgctgcagctcgggcctgggcccggtctcgccggcg
ctgctgcgctcgggggccttcgtgcggggccgctggctgcaagccggagcctctttcccc
gtgcgggaccccggcagcggcgccgaacttggccgggtggccgactgcggggcggaggag
gcccaggccgccgtgaaagccgcctacgaggccgggcccgcttggagcaaagccaccgcc
aaggaaagaagtacattacttcgcaaatggtatgatttgatgatagagaacaaagatgac
ctcgccaggatcattacagcagagaatgggaaaccactgaaagaagcgcaaggggagatc
ctatattctgcttctttcttggaatggtttgccgaagaagctcgacgcgtttatggcgat
atcatcccatcttctgcaaaagataggcgattcttggtgctgaaacagcctgtgggggtt
gctgccatcattaccccttggaatttcccaagtgctatgatcacaagaaaagtgggtgca
gctctggccgctggttgtacggtggtagtgaagccagcagaagatacacctttatctgca
ttagcacttgctgagcttgcaaaccaggctggaattcctgctggagtatacaatgtggtc
ccatgttctagacaacaggcaccagcggttggggaagtgttgtgcacagatccattggtc
tccaaaatctcttttactggctcaacagccacaggaaagatactgctgcgccatgctgct
ggcactgtgaagagggtctccatggagcttggaggacatgctccattcatagtgtttgac
agcgctgatgtagacaaggctgtcacaggagcgttaatgtccaaatacagaaactcgggc
cagacttgtgtttgcacaaatcggttcttggtgcaaaaagggatccatgatgcatttgtg
gaaaagtttgcagaagtcataaaaagagagctgcatgttggctatggttttgatgaaggg
actacgcaggggccactaattaatgaaaaagcagtggaaaaagttgaaaatcacatccac
gatgcagtatcacatggtgcttccattgttactggagggaaacgacacagttatgggaag
aatttctttgagccgactctacttagcaatgtcaccacaagcatgctatgtacgcaagag
gaaacatttggtcctctggccccagttatcaagtttgatacagaggaagaagctcttgcc
atagcaaattcaactaacgtgggtttagcaggctatttctactcccgagatcctgcccag
atttggagagttgcggagcagctggaagttgggatggttggtattaatgaaggacttctg
tcttccgtggagtgtccatttggtggcgttaaacaatctggtttaggaagagaaggttca
aaatatggcattgatgagtatctggaaataaagtatgtctgttttggaggattgcagtag

DBGET integrated database retrieval system