KEGG   Anolis carolinensis (green anole): 100567684Help
Entry
100567684         CDS       T01608                                 

Definition
cytochrome P450 1A5-like
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100567684
  Amino acid metabolism
   00380 Tryptophan metabolism
    100567684
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100567684
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100567684
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100567684
Cytochrome P450 [BR:acs00199]
 Cytochrome P450, animal type
  CYP1 family
   100567684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 519 aa AA seqDB search
MPTLEMSSMESLSHITATEALIATAVFCLLFMIVKSFRNRVPHGLKKIPGPMGYPLIGNM
LELGKNPHLSLTRMSQKYGDVMMIHIGSTPVLVLSGLETIRKALVRQGAEFLGRPDLYSF
RYVADGESLAFGHDSGEVWRTRRKLAQNALKSFAASPSPVSPSIYLLEEHLSKEVDYLIQ
KLQEVMREKKSLDPYRYIVVSVANVICAMCFGKRYSHDNQEFLSIIDESEKFVEVAASGN
LADFIPLLQYLPMRSMKMFKQFNEKFTVFLLNMVKEHYESFSKDSIRDITDSLIEQSQEK
FQISSKKIVNLVNDIFGAGFDTVTTTLSWSLMYLVTHPEIQKKIHEEIDEVIGRERKPRL
SDRLLMPYTEAFTMEVFRHSSLLPFTIPHCTVKETSLNGYYIPKDLCVFVNQWQVNHDEK
LWKDPSSFNPERFLSADGKDVNKDESEKVLTFGLGKRRCIGEQIARWEVFLFLTFLLQEL
EFSVKEGVEVDMTPRYGLSMKHKRCPHFLVKPRPPKNAS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccttggagatgtcatccatggaaagcctgagccatatcacagcaacggaagct
ctcattgccacggctgttttctgtttactctttatgattgtcaagtcctttcggaaccgg
gttcctcatggcctgaagaaaatcccggggccgatggggtacccactcattggcaacatg
ttggagttggggaaaaacccccacctgagcctgacacggatgagccagaaatacggagac
gtgatgatgatccatattggcagcacacctgtgttggtgctgagtgggctggaaaccata
cggaaagccttggtgaggcaaggagctgagttcttgggacggccggacctctacagcttc
cgttacgtggccgacggggaaagcctggcttttggccacgattcgggagaagtctggcgc
acccggcggaaactggcccagaatgccttaaagtcctttgctgcttcgcccagccccgtc
tcaccttccatatatctcctagaagagcatctctccaaagaggttgactacttgatccag
aagttgcaagaggtgatgcgggagaagaagtccctggacccttaccgatacatcgtggtc
tccgtggccaacgtcatttgcgccatgtgttttggcaaacgttacagccacgacaaccag
gaattcctcagcatcattgacgagagtgaaaagtttgtggaagtggctgcctcggggaac
cttgcggatttcatcccgctgcttcaatatctcccgatgaggagcatgaagatgttcaag
caattcaacgagaagttcactgttttcttactcaatatggtcaaggaacactatgagagt
ttcagtaaggatagtatccgggacatcaccgattctctcattgagcaaagccaggaaaag
tttcagatctcctctaaaaaaatagtcaaccttgtcaatgacatctttggagctggtttc
gacacagtgaccacaactttgtcctggtcactcatgtaccttgtcactcaccctgaaatt
cagaagaagatccatgaagaaatagatgaagtcattggcagagaacgaaaacctcggctg
tcggaccgacttctgatgccttatacagaggccttcaccatggaagtgttcaggcattcc
tctcttctccctttcacaattccccattgcacagtcaaagaaacctctctcaatggctac
tacatcccaaaggacctctgtgtctttgtcaaccagtggcaagtcaaccacgatgagaag
ctttggaaagacccctcttccttcaacccggagcgcttcctttccgccgacggcaaagac
gtcaacaaggacgagagcgagaaagtgctgacctttggtctggggaagagacgatgcatc
ggggagcagatcgcccgatgggaggtcttcctcttcttgacctttttgctccaagagttg
gaattcagcgtcaaggaaggcgtggaagtggacatgactccccgctacggcctctccatg
aagcacaagcggtgcccgcatttcctagtcaagccacggcccccaaagaacgccagctag

DBGET integrated database retrieval system