KEGG   Anolis carolinensis (green anole): 100567684Help
Entry
100567684         CDS       T01608                                 

Definition
cytochrome P450 1A5-like
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:acs00140]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:acs00380]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:acs00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:acs00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 514 aa AA seqDB search
MSSMESLSHITATEALIATAVFCLLFMIVKSFRNRVPHGLKKIPGPMGYPLIGNMLELGK
NPHLSLTRMSQKYGDVMMIHIGSTPVLVLSGLETIRKALVRQGAEFLGRPDLYSFRYVAD
GESLAFGHDSGEVWRTRRKLAQNALKSFAASPSPVSPSIYLLEEHLSKEVDYLIQKLQEV
MREKKSLDPYRYIVVSVANVICAMCFGKRYSHDNQEFLSIIDESEKFVEVAASGNLADFI
PLLQYLPMRSMKMFKQFNEKFTVFLLNMVKEHYESFSKDSIRDITDSLIEQSQEKFQISS
KKIVNLVNDIFGAGFDTVTTTLSWSLMYLVTHPEIQKKIHEEIDEVIGRERKPRLSDRLL
MPYTEAFTMEVFRHSSLLPFTIPHCTVKETSLNGYYIPKDLCVFVNQWQVNHDEKLWKDP
SSFNPERFLSADGKDVNKDESEKVLTFGLGKRRCIGEQIARWEVFLFLTFLLQELEFSVK
EGVEVDMTPRYGLSMKHKRCPHFLVKPRPPKNAS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccatggaaagcctgagccatatcacagcaacggaagctctcattgccacggct
gttttctgtttactctttatgattgtcaagtcctttcggaaccgggttcctcatggcctg
aagaaaatcccggggccgatggggtacccactcattggcaacatgttggagttggggaaa
aacccccacctgagcctgacacggatgagccagaaatacggagacgtgatgatgatccat
attggcagcacacctgtgttggtgctgagtgggctggaaaccatacggaaagccttggtg
aggcaaggagctgagttcttgggacggccggacctctacagcttccgttacgtggccgac
ggggaaagcctggcttttggccacgattcgggagaagtctggcgcacccggcggaaactg
gcccagaatgccttaaagtcctttgctgcttcgcccagccccgtctcaccttccatatat
ctcctagaagagcatctctccaaagaggttgactacttgatccagaagttgcaagaggtg
atgcgggagaagaagtccctggacccttaccgatacatcgtggtctccgtggccaacgtc
atttgcgccatgtgttttggcaaacgttacagccacgacaaccaggaattcctcagcatc
attgacgagagtgaaaagtttgtggaagtggctgcctcggggaaccttgcggatttcatc
ccgctgcttcaatatctcccgatgaggagcatgaagatgttcaagcaattcaacgagaag
ttcactgttttcttactcaatatggtcaaggaacactatgagagtttcagtaaggatagt
atccgggacatcaccgattctctcattgagcaaagccaggaaaagtttcagatctcctct
aaaaaaatagtcaaccttgtcaatgacatctttggagctggtttcgacacagtgaccaca
actttgtcctggtcactcatgtaccttgtcactcaccctgaaattcagaagaagatccat
gaagaaatagatgaagtcattggcagagaacgaaaacctcggctgtcggaccgacttctg
atgccttatacagaggccttcaccatggaagtgttcaggcattcctctcttctccctttc
acaattccccattgcacagtcaaagaaacctctctcaatggctactacatcccaaaggac
ctctgtgtctttgtcaaccagtggcaagtcaaccacgatgagaagctttggaaagacccc
tcttccttcaacccggagcgcttcctttccgccgacggcaaagacgtcaacaaggacgag
agcgagaaagtgctgacctttggtctggggaagagacgatgcatcggggagcagatcgcc
cgatgggaggtcttcctcttcttgacctttttgctccaagagttggaattcagcgtcaag
gaaggcgtggaagtggacatgactccccgctacggcctctccatgaagcacaagcggtgc
ccgcatttcctagtcaagccacggcccccaaagaacgccagctag

DBGET integrated database retrieval system