KEGG   Anolis carolinensis (green anole): 100567733Help
Entry
100567733         CDS       T01608                                 

Definition
ubiquitin carboxyl-terminal hydrolase 7-like
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Pathway
FoxO signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100567733
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100567733
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100567733
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100567733
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1066 aa AA seqDB search
MNHHHQQPQPPPPPPKPGEQQLSEPEDMEMEAGDADDPPRITQNPVINGNVAMADGHNNT
EEDMEDDTSWRSEATFQFTVERFNRLSESVLSPPCFVRNLPWKIMVMPRLYPDRPHQKSV
GFFLQCNAESRPKEKLVTNSMCKRDGYIEDDKVTFEVSVQADAPHGVAWDSKKHTGYVGL
KNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGT
KKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKH
VDYRSERIEDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFI
TLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPDQLPLDEFLQKTDPKDAANYILHAVLVH
SGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYML
VYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVTEDQFC
GHQGNDMYDEEKVKYTVFKVLKNSTLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPA
MLDNEADGNKTMIELSDNENPWTIFLETVDPEMAATGATLPKFDKDHDVMLFLKMYDPKT
RSLNYCGHIYTPISCKIRDLLPVMCERAGFPQESNLILYEEVKPNLTERIQDYDVSLDKA
LDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNR
MNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYDGTLRDLLQFFKPRQPKKL
YYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLDECKKAVELAERGS
GKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDLDKENEMLITVAHFQ
KEVFGTFGTPFLLRIHQGEHFREVMKRIQVVLDIQEKEFEKFKFAIVMMGRHQYLNEDEY
EVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccaccaccagcagccccagcccccaccgccgccgcccaagcccggggagcag
cagctaagcgagcccgaggacatggagatggaagctggagatgctgatgatccaccaaga
attactcaaaatccagtcatcaatgggaatgtggcaatggctgacggccacaacaacaca
gaagaagacatggaagatgacacaagttggcggtcagaagcaacctttcagttcacggtc
gagcgttttaaccggctgagcgaatcagtcctgagccccccctgctttgtccgaaacctg
ccctggaagatcatggtgatgccccggctttacccggaccggccgcaccaaaaaagtgta
ggattctttcttcagtgcaatgctgagagcagaccaaaggaaaagctagtaacaaattca
atgtgcaaaagggatggctatatagaagatgataaagtaacttttgaagtctctgttcaa
gctgacgctccgcatggtgtggcgtgggattccaagaagcacacaggctacgtggggctg
aagaaccagggagcaacctgctacatgaacagtttgttacagactttatttttcacaaac
cagctacggaaggctgtgtatatgatgcccacagaaggggatgattcatcaaaaagtgtc
cctttagccttgcaaagggtgttctatgagcttcagcacagcgacaagccagtaggaacg
aagaagctaacaaaatcctttggatgggagacgctagacagcttcatgcaacatgacgtc
caagagctttgtcgagtgctgcttgacaacgttgaaaataaaatgaaaggcacctgtgtt
gaaggcacgatcccgaaattattccggggcaaaatggtgtcttatatccagtgcaaacat
gtagactaccggtctgaacgaatagaggattattatgacatccaactaagtataaaggga
aagaagaacatatttgagtccttcatcgattacgttgcagtggaacagctggatggagac
aacaaatacgatgcaggggaacacggtttgcaggaggccgagaaaggtgtgaaattcata
acgctgccaccggtgttgcatctgcaactcatgaggttcatgtatgatcctcagacagac
cagaacatcaagataaatgacaggtttgaatttccagaccagttgcctctggatgagttc
ttgcaaaaaacagatccgaaagatgctgcaaactacatccttcacgctgtgcttgtgcac
agcggggataaccatggtggacattacgtagtgtacttgaaccccaaaggggatggaaaa
tggtgtaaatttgatgacgacgttgtctctcggtgtacaaaagaagaagccattgagcat
aactatggaggccacgatgatgacctatctgtacggcactgtacaaatgcatatatgttg
gtttatatcagggagtcaaaattaagtgaggttttgcaggctgtcaccgaccacgacatt
cctcagcaactcgtggaacggcttcaggaagagaagcgaatagaggcccaaaagcggaag
gagaggcaggaggctcatctctacatgcaagtgcagatcgtaacagaggaccagttctgt
ggccaccaaggcaacgacatgtacgatgaagaaaaagtgaaatatactgtgttcaaagtc
ttgaagaactcaacacttgcagagtttgtccagaacctttctcaaaccatgggctttcca
caagatcaaatacggctgtggcccatgcaggcgcgaagcaacgggacaaagaggccggcc
atgctagacaatgaagccgacggcaataaaaccatgattgaactcagtgacaatgaaaat
ccatggacaatattcctggagacagtcgacccagaaatggctgcaacaggagcaacgttg
cccaaatttgacaaagaccatgatgtcatgctgttcttgaaaatgtatgacccaaagact
cggagtttaaactactgtggacatatctacacacctatatcctgcaaaatacgtgacttg
ctgccagttatgtgtgagagagcaggatttccccaagaatctaatcttatcctctatgag
gaagttaaaccgaatttaacagagcggattcaagactatgacgtttccctcgacaaagct
ctggacgaactcatggacggcgacatcatcgtgtttcaaaaagacgaccccgagaacgac
aacagcgaactgcccacggcaaaagagtacttccgagacctgtaccaccgcgtcgacgtc
atcttctgtgacaaaaccatcccgaacgaccctggcttcgtggtcacgctgtccaacagg
atgaactatttccaggttgccaagaccgtcgcccagaggcttaatactgatcctatgctc
ctacagtttttcaagtcacaaggttacagagatggcccaggcaacccacttagacataat
tacgatgggactttgagggatcttctgcaattctttaagccgaggcaacctaagaaactg
tactatcagcagctcaaaatgaaaatcacggacttcgaaaaccggaggagtttcaagtgc
atatggctgaacagccagtttagggaagaggaaataacactatatccagacaagcacgga
tgcgtccgggacctattagacgaatgtaaaaaagctgtagaacttgctgagagaggttca
gggaaactaaggctgctagaaattgtaagttacaaaataatcggggtccatcaggaagat
gaattgttagagtgtttatcgccagcgacaagtcgaacgtttcgaatagaggaaatcccc
ctggaccaggtcgatctcgataaggagaacgagatgcttattacagtggctcacttccag
aaagaggtctttgggacatttggcactcctttcttgctaaggatacaccagggcgaacac
tttcgagaggtgatgaagaggattcaagtcgtcctggacatccaggagaaggaattcgaa
aagtttaaatttgccattgtaatgatgggtcggcaccagtatctaaacgaagacgaatat
gaagtgaacttgaaagatttcgagccccaacccggaaacatgtctcacccaaggccatgg
ctaggacttgaccatttcaacaaagccccaaagagaagtcgctacacgtaccttgaaaaa
gctattaaaatccataactga

DBGET integrated database retrieval system