KEGG   Anolis carolinensis (green anole): 100567733Help
Entry
100567733         CDS       T01608                                 

Gene name
usp7
Definition
ubiquitin specific peptidase 7 (herpes virus-associated)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Pathway
FoxO signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100567733 (usp7)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100567733 (usp7)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100567733 (usp7)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100567733 (usp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1083 aa AA seqDB search
MNHHHQQPQPPPPPPKPGEQQLSEPEDMEMEAGDADDPPRITQNPVINGNVAMADGHNNT
EEDMEDDTSWRSEATFQFTVERFNRLSESVLSPPCFVRNLPWKIMVMPRLYPDRPHQKSV
GFFLQCNAESMRERQGSHNSNSNSNKKKPPPIAPGFCAFLCKGYIEDDKVTFEVSVQADA
PHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLA
LQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGT
IPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKY
DAGEHGLQEAEKGVKFITLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPDQLPLDEFLQK
TDPKDAANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYG
GHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQ
EAHLYMQVQIVTEDQFCGHQGNDMYDEEKVKYTVFKVLKNSTLAEFVQNLSQTMGFPQDQ
IRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPEMAATGATLPKF
DKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFPQESNLILYEEVK
PNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFC
DKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYDG
TLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVR
DLLDECKKAVELAERGSGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQ
VDLDKENEMLITVAHFQKEVFGTFGTPFLLRIHQGEHFREVMKRIQVVLDIQEKEFEKFK
FAIVMMGRHQYLNEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIK
IHN
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccaccaccagcagccccagcccccaccgccgccgcccaagcccggggagcag
cagctaagcgagcccgaggacatggagatggaagctggagatgctgatgatccaccaaga
attactcaaaatccagtcatcaatgggaatgtggcaatggctgacggccacaacaacaca
gaagaagacatggaagatgacacaagttggcggtcagaagcaacctttcagttcacggtc
gagcgttttaaccggctgagcgaatcagtcctgagccccccctgctttgtccgaaacctg
ccctggaagatcatggtgatgccccggctttacccggaccggccgcaccaaaaaagtgta
ggattctttcttcagtgcaatgctgagtctatgagagaaagacaaggtagtcataatagt
aatagtaacagtaacaagaagaagccacctcccatagcccctgggttttgtgccttcctg
tgcaaaggctatatagaagatgataaagtaacttttgaagtctctgttcaagctgacgct
ccgcatggtgtggcgtgggattccaagaagcacacaggctacgtggggctgaagaaccag
ggagcaacctgctacatgaacagtttgttacagactttatttttcacaaaccagctacgg
aaggctgtgtatatgatgcccacagaaggggatgattcatcaaaaagtgtccctttagcc
ttgcaaagggtgttctatgagcttcagcacagcgacaagccagtaggaacgaagaagcta
acaaaatcctttggatgggagacgctagacagcttcatgcaacatgacgtccaagagctt
tgtcgagtgctgcttgacaacgttgaaaataaaatgaaaggcacctgtgttgaaggcacg
atcccgaaattattccggggcaaaatggtgtcttatatccagtgcaaacatgtagactac
cggtctgaacgaatagaggattattatgacatccaactaagtataaagggaaagaagaac
atatttgagtccttcatcgattacgttgcagtggaacagctggatggagacaacaaatac
gatgcaggggaacacggtttgcaggaggccgagaaaggtgtgaaattcataacgctgcca
ccggtgttgcatctgcaactcatgaggttcatgtatgatcctcagacagaccagaacatc
aagataaatgacaggtttgaatttccagaccagttgcctctggatgagttcttgcaaaaa
acagatccgaaagatgctgcaaactacatccttcacgctgtgcttgtgcacagcggggat
aaccatggtggacattacgtagtgtacttgaaccccaaaggggatggaaaatggtgtaaa
tttgatgacgacgttgtctctcggtgtacaaaagaagaagccattgagcataactatgga
ggccacgatgatgacctatctgtacggcactgtacaaatgcatatatgttggtttatatc
agggagtcaaaattaagtgaggttttgcaggctgtcaccgaccacgacattcctcagcaa
ctcgtggaacggcttcaggaagagaagcgaatagaggcccaaaagcggaaggagaggcag
gaggctcatctctacatgcaagtgcagatcgtaacagaggaccagttctgtggccaccaa
ggcaacgacatgtacgatgaagaaaaagtgaaatatactgtgttcaaagtcttgaagaac
tcaacacttgcagagtttgtccagaacctttctcaaaccatgggctttccacaagatcaa
atacggctgtggcccatgcaggcgcgaagcaacgggacaaagaggccggccatgctagac
aatgaagccgacggcaataaaaccatgattgaactcagtgacaatgaaaatccatggaca
atattcctggagacagtcgacccagaaatggctgcaacaggagcaacgttgcccaaattt
gacaaagaccatgatgtcatgctgttcttgaaaatgtatgacccaaagactcggagttta
aactactgtggacatatctacacacctatatcctgcaaaatacgtgacttgctgccagtt
atgtgtgagagagcaggatttccccaagaatctaatcttatcctctatgaggaagttaaa
ccgaatttaacagagcggattcaagactatgacgtttccctcgacaaagctctggacgaa
ctcatggacggcgacatcatcgtgtttcaaaaagacgaccccgagaacgacaacagcgaa
ctgcccacggcaaaagagtacttccgagacctgtaccaccgcgtcgacgtcatcttctgt
gacaaaaccatcccgaacgaccctggcttcgtggtcacgctgtccaacaggatgaactat
ttccaggttgccaagaccgtcgcccagaggcttaatactgatcctatgctcctacagttt
ttcaagtcacaaggttacagagatggcccaggcaacccacttagacataattacgatggg
actttgagggatcttctgcaattctttaagccgaggcaacctaagaaactgtactatcag
cagctcaaaatgaaaatcacggacttcgaaaaccggaggagtttcaagtgcatatggctg
aacagccagtttagggaagaggaaataacactatatccagacaagcacggatgcgtccgg
gacctattagacgaatgtaaaaaagctgtagaacttgctgagagaggttcagggaaacta
aggctgctagaaattgtaagttacaaaataatcggggtccatcaggaagatgaattgtta
gagtgtttatcgccagcgacaagtcgaacgtttcgaatagaggaaatccccctggaccag
gtcgatctcgataaggagaacgagatgcttattacagtggctcacttccagaaagaggtc
tttgggacatttggcactcctttcttgctaaggatacaccagggcgaacactttcgagag
gtgatgaagaggattcaagtcgtcctggacatccaggagaaggaattcgaaaagtttaaa
tttgccattgtaatgatgggtcggcaccagtatctaaacgaagacgaatatgaagtgaac
ttgaaagatttcgagccccaacccggaaacatgtctcacccaaggccatggctaggactt
gaccatttcaacaaagccccaaagagaagtcgctacacgtaccttgaaaaagctattaaa
atccataactga

DBGET integrated database retrieval system