KEGG   Anolis carolinensis (green anole): 100567785Help
Entry
100567785         CDS       T01608                                 

Gene name
ptprr
Definition
protein tyrosine phosphatase, receptor type, R
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100567785 (ptprr)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100567785 (ptprr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 645 aa AA seqDB search
MCVSSFAGCFSGDNDHILAIHQKKSRKPIFIYHHVQSVEKSLDTNDQKDYGPNFYLPSKA
KISKLHSAIMVKSAFSQPAHDPSLSLLAMTDGEDQEVENLSIPPANVITVTLQMDVNKLN
ITLLRIFRQGVAAALGLLPQQVHINRLLVKKNCVELFVSPVNRKGVYDTLPSEEVLRSLN
INVLHQSLSQFGITDVSPEKNVLQGKHESGKLWSKEGFYAVIIFLSIFVIIVTCLMVLYR
LKEKIQFSVRQDKHKKQEIHLSSVPLQKAPSEYKAASRMVQPEQAPKVVNVVVDPQGQCP
PEFKSSLSASPSPFKMKPVGLQERRGSNVSLTLDMSSLGSVEPFVAVPTPREKVAMEYLQ
SASRILTRQQLKDTVASSHLLQTEFMEIPMNFVDPKELDIPSHGTKNRYKTILPNPVSRV
SLKPKYPGDTLSTYINANYIKGYSGREKAFIATQGPMINTVNDFWQMVWQEDSPVIVMIT
KLKEKNEKCVLYWPEKRGIYGKVEVLVNSVQECENYTVRNLTLKQGSQSRQVKHYWYTSW
PDHKTPDSAQPLLQLMLDVEEDREPSVGRGPVIVHCSAGIGRTGCFIATTIGCHQLKEEG
VVDALSIVCQLRLDRGGMVQTSEQYEFVHHALSLYESRLSAEVVP
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtgtcttcttttgcaggctgcttttcaggagacaatgaccacattttggcaatt
catcaaaaaaagagcaggaagcccatattcatttaccaccatgtgcaaagtgtagaaaaa
agtttggataccaatgatcagaaggattatgggcccaatttctacttgccttccaaggca
aaaataagcaaactgcactctgctattatggtgaaatcagcattctctcaacctgcacat
gacccgtccctcagtctcttagctatgactgatggagaggatcaggaagtggaaaatctg
tccatcccacctgctaatgtgatcaccgtgactcttcaaatggatgtaaacaagctgaat
atcacattgcttcggatcttccgtcaaggagtagctgctgctttaggactgctgccacag
caagtgcacatcaacaggctccttgtcaagaaaaactgtgttgagctctttgtatcaccg
gtaaataggaaaggagtctatgatacactcccatcagaagaagtcctgaggtctcttaac
atcaatgtactccaccagagtttatcccagtttgggattacagatgtctcaccagagaaa
aatgttctgcaaggcaagcacgaatcaggcaaactctggagcaaagaagggttttatgct
gtcatcatctttctcagcatctttgttattattgtgacatgtctgatggttctgtatcga
ctgaaagagaaaatacaattttcagtgaggcaagataagcacaaaaaacaggaaatacac
ctttcttccgtcccacttcagaaagctccatctgagtacaaagcagcaagcagaatggtt
caaccggaacaagctcctaaagttgtaaatgttgtagtagatcctcaaggacaatgtcct
cctgagttcaagtccagcctttcggctagcccatcacctttcaaaatgaaaccagtggga
ttgcaagaaaggcgcggatccaatgtttcactcaccttagacatgagcagcttaggaagt
gttgaaccttttgtagctgtgcccacgccaagagaaaaagtagcaatggagtacctccag
tctgcaagccggatcttgacaaggcagcagttaaaagacactgttgcaagttctcatttg
cttcagacagaattcatggaaattcccatgaattttgtggatcctaaagaacttgacatt
cccagccatggaacaaaaaatcgttataaaaccatccttccaaatcctgtaagcagagtc
agtttgaaaccaaagtacccaggggataccttgagcacctatataaatgcaaactacatc
aagggttacagtggccgggagaaagctttcattgcaactcagggacccatgattaataca
gtcaatgatttctggcagatggtatggcaagaggatagtcctgttattgttatgatcaca
aaacttaaagagaaaaatgagaaatgtgtgctctattggccagagaagagaggaatctat
gggaaagtagaagtacttgtcaacagtgtgcaagaatgtgaaaattatactgtccgtaat
cttacactaaagcaaggaagccagtcaagacaagtcaaacactactggtacacatcctgg
ccagaccataaaaccccagatagtgctcaaccacttttacagctcatgctggatgttgaa
gaagatagggagccatcagttggaagaggacctgtcattgtgcattgcagtgctggaata
ggaagaactggatgctttattgctactactattgggtgtcatcaactcaaggaagaagga
gttgttgatgcattaagcattgtctgccaactgcgtttggacagaggtggaatggtccaa
accagtgaacagtatgaatttgtgcatcatgccttgagcctctatgaaagcagactctct
gctgaagtggtcccatga

DBGET integrated database retrieval system