KEGG   Anolis carolinensis (green anole): 100567877Help
Entry
100567877         CDS       T01608                                 

Gene name
cltc
Definition
clathrin, heavy chain (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
acs  Anolis carolinensis (green anole)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100567877 (cltc)
   04142 Lysosome
    100567877 (cltc)
Exosome [BR:acs04147]
 Exosomal proteins
  Proteins found in most exosomes
   100567877 (cltc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 1687 aa AA seqDB search
MEPQNANNASGAMAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQA
QVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDV
TFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLT
GISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKL
HIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLE
TGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLA
LRMAVRNNLAGAEELFARKFNALFAQGSYSEAAKVAANAPKGILRTPDTIRRFQSVPAQP
GQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVK
SVDPTLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQ
GQQFAQMLVQDEEPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMN
LMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNP
EWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSF
EGLFYFLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKL
TDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDV
IKNLILVVRGQFSTDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNN
NPERFLRENPFYDSRVVGKYCEKRDPHLACVAYERGQCDQELIHVCNENSLFKSLSRYLV
RRKDPDLWASVLLESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELL
EKIVLDNSVFSEHRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEA
FAIFRKFDVNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSY
IKADDPSSYMEVVQAANASGNWEELVKYLQMARRKARESYVETELIFALAKTNRLAELEE
FINGPNNAHIQQVGDRCYEEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKAN
STRTWKEVCFACVDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLESALG
LERAHMGMFTELAILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWGELVFLYDKY
EEYDNAIITMMNHPTDAWKEGQFKDIITKVANVELYYKAIQFYLEFKPLLLNDLLMVLSP
RLDHTRAVNYFSKVKQLPLVKPYLRSVQNHNNKAVNESLNNLFITEEDYQALRTSIDAYD
NFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDRLYKDAMQYASESKDTE
LAEELLQWFLQEGKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLT
KVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQ
PGFGYTM
NT seq 5064 nt NT seq  +upstreamnt  +downstreamnt
atggagccccagaacgccaacaacgcctcgggcgccatggcgcagatcctccccatccgc
ttccaggagcatctccagctccagaatttaggcattaatccggccaacattggcttcagc
actctgaccatggagtctgacaaattcatctgcatacgagagaaagtaggagagcaggcc
caggtggtcatcattgacatgaatgatcccagcaatcccatccgcaggcccatctccgca
gacagcgccatcatgaaccctgccagcaaggtcattgctctcaaagctgggaagactctc
cagatctttaacattgaaatgaagagcaaaatgaaggctcataccatgactgacgatgtc
accttttggaaatggatctctctgaacacggttgcgctagtgaccgacaatgctgtctac
cactggagcatggaaggagagtcccagccagtcaaaatgtttgatcgccactctagtctt
gccggctgccagataatcaactaccgtactgatgctaagcagaaatggttgcttttgact
ggtatatctgcacagcaaaaccgtgtagtaggagccatgcagctttattctgtagatagg
aaagtgtcccagccgatcgagggccatgccgctagcttcgcacagttcaagatggagggc
aatgctgaagagtccacccttttctgctttgcggtccgaggacaagctggaggcaagttg
catatcatcgaggttggcacaccccccaccggaaaccagccctttcccaaaaaggcagtg
gatgtcttcttcccacccgaagcacagaatgacttcccggttgccatgcagattagtgaa
aagcacgacgtggtcttcttgatcaccaaatacggttacatccatctctatgaccttgaa
acaggcacctgcatctatatgaaccggattagtggcgagaccatctttgtcactgctcct
cacgaagccacggctggaatcattggggtcaacagaaaaggacaggtcctctcggtgtgt
gtcgaggaagagaacatcatcccgtacatcaccaacgtgttgcagaaccccgacctggcg
ctgcggatggccgtccgtaacaacctggctggtgccgaagaactctttgcccgaaaattc
aatgccctttttgcccaagggagctattcggaagcggcaaaagtggcagcaaatgccccc
aagggaatattgcgtacgccagacaccatccgccggttccagagtgtcccagcgcagccg
ggccagacctctcccctgcttcagtattttgggatcctactcgaccaagggcagctgaac
aagtatgagtccttggagctctgccggccggtcctccagcagggacgcaagcagctcctg
gagaaatggttgaaggaagataagctggaatgctcagaagaactgggagatctggtgaaa
tctgtggatccaacgctggctctgagcgtctacctgagagccaacgtccccaacaaagtt
atccagtgttttgctgaaacaggacaagtccagaagattgtgctctatgccaaaaaggtt
ggctacactcccgactggatctttctcctgaggaacgttatgcggatcagcccagaccaa
ggacagcagtttgcccaaatgctggttcaggatgaagagccccttgcagatatcacccaa
attgtggatgtgttcatggagtacaacctgattcagcagtgtacagccttcttgttggac
gccctcaaaaacaaccgcccctccgagggccctctgcagacccgcttgcttgaaatgaac
ctcatgcatgccccccaggttgcggatgccatcttgggcaaccagatgttcactcactac
gaccgggcccacattgcccagctgtgcgagaaggctggcctcctccagcgagccctggaa
cacttcaccgacttgtacgatatcaagcgtgccgtcgttcacactcatcttctcaaccct
gagtggctggtgaactattttggctccctgtctgtggaagactccctggaatgcctgcgt
gccatgctttccgccaacatccgccagaacttgcagatttgtgtccaggtggcctccaag
taccacgagcagctttcaacacagtccctcatcgaactgttcgaatccttcaagagcttt
gaaggtctcttctatttcctgggctccatcgtcaacttcagccaggacccagacgtgcac
ttcaagtatatccaagcggcttgtaagacggggcaaattaaagaggtggagcggatttgc
cgagagagcaactgctatgacccggagcgggtgaagaacttcctcaaggaggcaaaactg
accgatcagcttccattgattattgtgtgcgaccgctttgactttgtccatgacctggtg
ctctacctgtacaggaacaacctccagaaatacattgaaatctatgttcaaaaggtgaac
ccaagccgcctgcctgtggtcattggaggcttgctggatgtggattgctctgaagatgtc
atcaagaacctgattctagtggtgaggggacagttctccacggatgagctggtggctgaa
gtggagaaaagaaataggttaaagctcctcctgccgtggctggaagctcggattcatgaa
ggctgtgaggagccggcgacgcataacgcgctagccaagatctacattgacagcaacaac
aaccctgagagattcctgcgggagaaccccttctatgacagccgcgtggtggggaagtat
tgtgagaagagagacccgcatctggcatgcgtggcatacgaacgggggcagtgcgaccag
gaacttattcacgtctgcaatgagaactccctcttcaagagcctgtctcgctacttggtg
cgccgcaaggaccccgacctgtgggccagtgtgctgctggaaagcaacccttaccgcagg
cccctcatcgaccaggtggtccagacggcgctctccgagactcaggatcccgaagaagtg
tccgtcacggtcaaggcgttcatgacggcagaccttcccaacgaactcattgagctgctg
gagaagattgtgcttgataactctgtcttcagtgaacacaggaacttgcagaacctcctc
attctgacggcgatcaaggcggaccgtacccgtgtcatggagtatatcaatcgcttggat
aactatgacgccccagatatcgccaacattgcgatcagcaacgagctttttgaggaggcc
tttgctatcttcaggaagtttgatgtcaacacctctgcagtgcaggttttgattgaacac
attgggaacctggaccgggcctatgagtttgcggagcgctgcaacgagccggccgtgtgg
agtcaactcgccaaagctcagcttcagaaagggatggtcaaggaagccatcgactcctac
atcaaagcagacgatccttcctcttacatggaagtggtccaggctgccaatgctagtggc
aactgggaggaactggtgaagtacttgcagatggcacgcaggaaggcccgggagtcctac
gtggagaccgagctgatttttgccctggcgaaaacaaaccgcttggccgagctggaggaa
ttcatcaatggacccaacaatgcccacattcagcaagttggtgaccgttgctacgaggaa
aagatgtacgacgcagccaagctcctctacaataacgtgtccaacttcggccgcttggct
tccaccctggtgcatctgggagaataccaggcagctgtcgacggggctcggaaagccaac
agcacccggacctggaaggaggtttgctttgcgtgtgtggatgggaaagagttccgcctg
gcccagatgtgcggcctccacattgtggtccatgcggatgaactggaggagctcatcaac
tactaccaggaccgtggctactttgaggagttgatcaccatgctggaatccgccttgggc
ctggagcgggcccacatggggatgttcacagagctggccatcctctactccaaattcaag
ccgcagaagatgagggagcacttggagctcttctggtcgcgagtcaacattcctaaggtg
ttgcgggccgctgaacaggcccacctttggggcgagctggtcttcctgtacgacaaatac
gaagaatacgacaatgccatcatcaccatgatgaaccacccgacagatgcctggaaggaa
gggcagttcaaggacatcatcactaaggtggccaatgtggagctctattacaaagcgatc
cagttctatttggagtttaaaccactgctgctcaacgacttgctcatggtgctctctccc
cggcttgaccatacccgggcggtcaactacttcagcaaggtgaaacagctgccgctggtg
aagccctacttgcgctccgtccagaaccacaacaacaaagccgtgaatgaatccctcaac
aacctcttcattacagaggaagattaccaggctctcaggacatcgatagatgcctacgac
aactttgacaacatctccctcgctcagcgcctggagaaacacgaattgattgagttccgg
aggattgcggcgtatcttttcaaaggcaacaaccgttggaaacagagcgtggagctctgc
aagaaagacaggctatacaaggatgccatgcagtatgcttccgagtccaaagacacggag
ttggcggaggagctcctgcagtggttcctgcaggaaggcaagcgggagtgttttggggcc
tgcctcttcacttgctacgacctcctccgacccgacgtggtcttggagacggcctggagg
cacaacatcatggacttcgccatgccctacttcatccaggtcatgaaggaatacttgacc
aaggtggacaagctagacgcctccgagtccctgaggaaagaggaagagcaagccacggag
acacagcccatcgtttatggccagccccagctgatgttgacggccggccccagcgtggca
gtcccgccgcaagcacctttcggctacggctacacggcccctccgtacgggcaaccccag
cccggctttggctacaccatgtaa

DBGET integrated database retrieval system