KEGG   Anolis carolinensis (green anole): 100567898Help
Entry
100567898         CDS       T01608                                 

Definition
d-beta-hydroxybutyrate dehydrogenase, mitochondrial-like
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:acs00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:acs00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 348 aa AA seqDB search
MAAIILADTCISLALAQPAMKAQPFRKTTSRLWSLSKFCSSLMNVRGQRSYGTEVEKIGE
RPVLITGCDSGFGFQLAKHLHGKGFIVYAGCLQKAQGKGGSKDLDDMKSDRMRTIQLDVC
SNEDVARALDHVTASLKNPEAGLWGVVNNAGISTFGEVEFTSMDTYKKLAEVNLWGTVRT
TKAFLPLIRRAKGRVVNITSMLGRMASPARSPYCITKFAVEAFSDCLRYEMQPHEVKVCI
VEPGNFIAGTSLYSSEGIKATAEKMWNEMPETVRQDYGRKYFDEQVAKMETYCQSGSTDL
SPVIESITHALTSPSPYTRYHPMDYYWWLRMQVMTHLPGAISDRLYIY
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcagccatcatcctagctgatacatgcatctctttagctcttgctcagccagctatg
aaagcccaaccgttcagaaaaaccaccagcagactttggtctctttcaaaattttgttct
tctctcatgaacgtgagggggcagcgctcctacggcacagaagtagaaaagattggcgag
cgacctgtcctcatcactggctgtgactctgggtttggtttccagctggccaagcaccta
catggaaagggtttcattgtctatgctggttgcctacagaaggcgcaaggcaagggaggc
tccaaagacctggatgacatgaaaagcgatcgcatgagaaccattcagctcgatgtctgt
agcaacgaagatgtggcgcgtgcattggaccatgtaactgcctctctgaagaacccagag
gctggactgtggggtgtagtcaacaacgctgggatctccacttttggggaggtagagttc
accagcatggacacctataaaaaactggctgaggtgaatctctgggggaccgtccgcact
acaaaggccttcctgcctctcatccggagggccaagggtcgcgttgtgaatataaccagc
atgctggggcggatggcaagcccagctcgctccccttattgcatcaccaagtttgctgtg
gaagccttctctgactgtctgcgctatgagatgcaaccccatgaggtcaaggtctgcatc
gtggaacccggaaatttcattgcaggcacaagcctgtacagctctgaaggcatcaaggcc
actgccgagaagatgtggaatgagatgcctgaaacagtgcggcaggattatggacggaag
tattttgatgagcaagtggccaagatggagacatactgccaaagtggctccacagacctt
tctcctgtcatcgagagcatcactcatgctctgacttctccctctccctatactcggtac
catcccatggactattactggtggctacgcatgcaagtgatgactcacttgccaggtgct
atttcggatcgcctgtacatttattaa

DBGET integrated database retrieval system