KEGG   Anolis carolinensis (green anole): 100567926Help
Entry
100567926         CDS       T01608                                 

Definition
cytochrome P450 2F2-like
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100567926
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100567926
Cytochrome P450 [BR:acs00199]
 Cytochrome P450, animal type
  CYP2 family
   100567926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F
AA seq 493 aa AA seqDB search
MDLSGATPLLLMAALFCLALYWNGGKRKKGKLPPGPAPLPIFGNLFQLDPREMHRSLEKL
SKQYGPVYTIHLGSLPCVVLCGYLAVKEALVDQADDFSDRGDFPVFYRFTQGNGIAFSNG
EKWKILRRFALHTLKNFGMGKSSIEARIQEEAQCLVQEFQKTDGAPFNPINLVCRAVSNV
ICAVVFGNRFDYEDADFLRLLDHFNENFQIMSSFWGELYNIFPHVMDLLPGPHHKIFQNF
EKLRHFITERIRLHQKDLDPEAPRDFIDCFLIRMEEEKQDPLSYFNMETLVMTTHNLFFG
GTETTSTTLRFSFLILMKYPDVAVRVHQEIDGVIGTNRTPCLADRKSMPYTDAVIYEIQR
FISILPMGLPRAVTRDTPFKEFLLPKGTNVIPLLSSVHYDPTQFKDPMSFNPDHFLDEKS
TFKNTDAFMPFAPGKRICLGAGLARMEIFLFLTTILQHFSLQPLVAPAEIDLTPQCTGLG
NVPRPFQFRVLPR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggatctcagcggggccaccccactgctcctgatggctgcccttttctgcctggctttg
tactggaatggaggcaagcgaaagaaggggaagctgccacctggaccagccccattgccc
atctttgggaatctcttccagttagaccccagagaaatgcaccgatctctggaaaagctc
agcaagcaatatggaccagtctacaccatccacttgggttcacttccatgtgtggtcttg
tgtggctacctagcggtgaaggaggccttggtggaccaagctgatgacttcagcgatcgc
ggggatttccctgtcttctaccgctttacccagggcaatggcattgccttctccaatggg
gaaaaatggaagatcttgcgtcgctttgccctgcacaccctgaagaattttgggatgggg
aaaagcagcatcgaggcccggatacaagaagaggcccagtgtcttgttcaggagtttcag
aaaactgatggagcacccttcaaccccatcaacctggtctgccgagccgtttccaacgtc
atctgtgctgtggtttttggcaaccgcttcgactacgaagatgccgacttccttaggctc
ctggatcactttaatgagaactttcagatcatgagttctttctggggtgagctctacaac
atcttcccccatgtgatggacctcctccctggaccccaccacaaaatcttccagaacttt
gaaaaacttcggcacttcatcactgagcgcattcgcttgcaccagaaagatctagaccct
gaggccccccgggatttcatcgactgcttccttatccgcatggaggaggaaaagcaagac
ccgctgagctactttaatatggagactttagtgatgaccacacacaacctgttctttgga
ggcacagagacaaccagtacgaccctccggttcagcttcctcatcctcatgaaataccct
gacgtggctgttcgtgtccaccaggagattgacggagtgattggcaccaaccgcactcca
tgtctcgctgaccgtaaaagcatgccgtacacggatgccgtcatctatgagatccagcgc
ttcatctccatcttgcccatgggactcccgcgggccgtgacccgggacaccccgttcaag
gaattcctccttccaaagggtaccaatgtcatccccctgctgagttcggtgcactacgac
cccacacagttcaaagatccaatgtccttcaacccagaccatttcttggatgagaaaagc
acattcaaaaatactgacgcattcatgccttttgctccaggaaaacggatctgcctggga
gcaggcttggcccggatggagatcttcctcttccttactaccatcctccaacacttctca
cttcaaccactggttgctcctgcagagatcgacctgacaccgcaatgcacaggcctgggc
aacgtcccccgtccattccagttccgggtcctccctcgctaa

DBGET integrated database retrieval system