KEGG   Anolis carolinensis (green anole): 100567926Help
Entry
100567926         CDS       T01608                                 

Definition
cytochrome P450 2F2-like
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Metabolism of xenobiotics by cytochrome P450
Class
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:acs00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F
AA seq 493 aa AA seqDB search
MDLSGATPLLLMAALFCLALYWNGGKRKKGKLPPGPAPLPIFGNLFQLDPREMHRSLEKL
SKQYGPVYTIHLGSLPCVVLCGYLAVKEALVDQADDFSDRGDFPVFYRFTQGNGIAFSNG
EKWKILRRFALHTLKNFGMGKSSIEARIQEEAQCLVQEFQKTDGAPFNPINLVCRAVSNV
ICAVVFGNRFDYEDADFLRLLDHFNENFQIMSSFWGELYNIFPHVMDLLPGPHHKIFQNF
EKLRHFITERIRLHQKDLDPEAPRDFIDCFLIRMEEEKQDPLSYFNMETLVMTTHNLFFG
GTETTSTTLRFSFLILMKYPDVAVRVHQEIDGVIGTNRTPCLADRKSMPYTDAVIYEIQR
FISILPMGLPRAVTRDTPFKEFLLPKGTNVIPLLSSVHYDPTQFKDPMSFNPDHFLDEKS
TFKNTDAFMPFAPGKRICLGAGLARMEIFLFLTTILQHFSLQPLVAPAEIDLTPQCTGLG
NVPRPFQFRVLPR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggatctcagcggggccaccccactgctcctgatggctgcccttttctgcctggctttg
tactggaatggaggcaagcgaaagaaggggaagctgccacctggaccagccccattgccc
atctttgggaatctcttccagttagaccccagagaaatgcaccgatctctggaaaagctc
agcaagcaatatggaccagtctacaccatccacttgggttcacttccatgtgtggtcttg
tgtggctacctagcggtgaaggaggccttggtggaccaagctgatgacttcagcgatcgc
ggggatttccctgtcttctaccgctttacccagggcaatggcattgccttctccaatggg
gaaaaatggaagatcttgcgtcgctttgccctgcacaccctgaagaattttgggatgggg
aaaagcagcatcgaggcccggatacaagaagaggcccagtgtcttgttcaggagtttcag
aaaactgatggagcacccttcaaccccatcaacctggtctgccgagccgtttccaacgtc
atctgtgctgtggtttttggcaaccgcttcgactacgaagatgccgacttccttaggctc
ctggatcactttaatgagaactttcagatcatgagttctttctggggtgagctctacaac
atcttcccccatgtgatggacctcctccctggaccccaccacaaaatcttccagaacttt
gaaaaacttcggcacttcatcactgagcgcattcgcttgcaccagaaagatctagaccct
gaggccccccgggatttcatcgactgcttccttatccgcatggaggaggaaaagcaagac
ccgctgagctactttaatatggagactttagtgatgaccacacacaacctgttctttgga
ggcacagagacaaccagtacgaccctccggttcagcttcctcatcctcatgaaataccct
gacgtggctgttcgtgtccaccaggagattgacggagtgattggcaccaaccgcactcca
tgtctcgctgaccgtaaaagcatgccgtacacggatgccgtcatctatgagatccagcgc
ttcatctccatcttgcccatgggactcccgcgggccgtgacccgggacaccccgttcaag
gaattcctccttccaaagggtaccaatgtcatccccctgctgagttcggtgcactacgac
cccacacagttcaaagatccaatgtccttcaacccagaccatttcttggatgagaaaagc
acattcaaaaatactgacgcattcatgccttttgctccaggaaaacggatctgcctggga
gcaggcttggcccggatggagatcttcctcttccttactaccatcctccaacacttctca
cttcaaccactggttgctcctgcagagatcgacctgacaccgcaatgcacaggcctgggc
aacgtcccccgtccattccagttccgggtcctccctcgctaa

DBGET integrated database retrieval system