KEGG   Anolis carolinensis (green anole): 100568210Help
Entry
100568210         CDS       T01608                                 

Gene name
hexa
Definition
(RefSeq) hexosaminidase subunit alpha
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00511  Other glycan degradation
acs00520  Amino sugar and nucleotide sugar metabolism
acs00531  Glycosaminoglycan degradation
acs00603  Glycosphingolipid biosynthesis - globo and isoglobo series
acs00604  Glycosphingolipid biosynthesis - ganglio series
acs01100  Metabolic pathways
acs04142  Lysosome
Module
acs_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100568210 (hexa)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100568210 (hexa)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100568210 (hexa)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100568210 (hexa)
   00511 Other glycan degradation
    100568210 (hexa)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100568210 (hexa)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100568210 (hexa)
Chaperones and folding catalysts [BR:acs03110]
 Intramolecular chaperones
  Others
   100568210 (hexa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 100568210
NCBI-ProteinID: XP_003229352
Ensembl: ENSACAG00000006553
UniProt: H9GBU5
Position
Un
AA seq 529 aa AA seqDB search
MAAAGACPGLLLLFLLSILGSRASVWPQPRSLSVSPLGGCLLNSRRFRFGYSKASAVGPG
CSVLDQAFQRYWKLLFPLGRREAGKHNSDVPVCPDLLVSVTEPGCDGYPSLDSQENYKLT
VSEKQMLLTADTVWGALRGLETFSQLPRSDEYGTFYVNKTDVVDFPRFPHRGVLLDTSRH
YLPLNVILETLDAMAYNKFNVFHWHIVDDPSFPYESLAFPDLSRKGAYDPATHVYTTSDV
KTVLEHARLRGIRVIPEFDTPGHTQSWGRGIPGLLTPCYAGQKPSGTYGPVNPILNATYD
IMTKFFDEVSLVFPDFYIHLGGDEVDFTCWKSNPDIKKFMQEMGFGTNFTMLESFYIQRL
LDIVSFYSKGYVVWQEVFDNQVKVKPDTVIHVWKQNDGTYPDETARVTKAGYRALLSAPW
YLNIISYGQDWVKIYEVEPLAFEGSPEQKKLVIGGEACMWGEYVDVTNLTPRLWPRAGAV
AERLWSNQTVRNVEDAYARLADFRCLLLRRGIRAEPLFTGYCDHEFSIV
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgggagcgtgtcctgggctgctgctcctcttccttctctcgattttgggc
tccagggcgtcggtctggccccagccgaggtctctgagtgtgtctccgctgggaggctgt
ctccttaactcgcgacgattccgcttcggttacagcaaggcctcggcggtgggtcccggc
tgctccgtcctggaccaggccttccaacgatactggaagctcctcttccccttgggacgc
agggaggccggcaagcacaactctgacgtccccgtctgccccgatcttctcgtctccgtt
acagagccaggttgcgatggctatccttcgctggactcccaagagaattataagctgaca
gtttcagagaagcagatgctgctgacagcagatactgtctggggagccctccgagggtta
gaaaccttctcccagcttccacggagcgatgagtatgggactttctatgtaaacaagacc
gatgttgtggacttcccccgctttcctcaccgaggggttttgctggacacgtctcgccat
tacctgcctttgaatgtcatcctggagaccctggatgccatggcctacaacaaattcaat
gtgtttcactggcatatagtggacgacccctcctttccctatgagagcctggcgttcccg
gatctcagcaggaagggggcctacgaccctgccactcatgtgtacacaactagtgatgtc
aagactgttcttgagcatgcccggttgcgtggcatcagggtgatcccggaattcgacact
cctggccacacccaatcttggggtcgaggtattcctggcttgctgactccctgctatgca
ggccagaagccctctggaacctatgggcccgtcaacccaatcctcaatgcaacatatgac
atcatgaccaagttttttgacgaagttagcctagtgtttccggacttctacatacacctg
ggaggagacgaggttgacttcacatgctggaagtctaatccagacatcaagaaattcatg
caggaaatggggtttggcacaaacttcaccatgttggagtccttctacatccaaaggctg
ctggatattgtctctttctacagcaagggctatgtggtatggcaggaggtctttgataac
caagtgaaggtgaagcctgatactgttattcacgtgtggaagcagaatgacgggacgtac
ccggacgagacggctcgtgtcaccaaagccggctatcgagccctgctctctgctccttgg
tatctgaacatcatctcttacggccaggactgggtgaagatttacgaggtggagcctctc
gcctttgaaggcagcccagagcagaagaaactggtgatcggcggggaggcctgtatgtgg
ggcgaatacgtggatgtgaccaacttgaccccaagactctggcctagagctggagccgta
gcagagagattatggagcaaccagacggtccggaacgtggaagatgcctatgcgagactg
gcagacttccgatgccttctgctcagacgtggaatccgggccgagccacttttcacagga
tactgtgaccacgaattcagcatagtttga

DBGET integrated database retrieval system