KEGG   Anolis carolinensis (green anole): 100568252Help
Entry
100568252         CDS       T01608                                 

Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform-like
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:acs00562]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:acs04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:acs04370]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:acs04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:acs04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:acs04070]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:acs04150]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:acs04810]
Cellular Processes; Cell growth and death; Apoptosis [PATH:acs04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:acs04510]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:acs04620]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:acs04910]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:acs04914]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:acs04261]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
H
AA seq 1051 aa AA seqDB search
MLPGIYCPVEFWSKEANQSIQVDFLLPTGIYLTLSVSCNATLGTIKQLVWHHAQCEPFFH
MLSDPESYVFTCINQTAERQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLISSQISLL
IGKGLHEFDSLGDLEVDDFRVKMQHFCEERAARRQQLSWKAWMEYSFPVQLEPLANGLGG
RSLLQFPNKNIFVNVKFESGGESFTFQISPKEYPATLMSYAIKKQATVFRHQKINSPEDY
ALQINGKYEYLYGNHPLYQFQYIRDCLCRGLLPHLTMVHASSISALWEEQTNGISYPIKA
ASKAPPVPKKKPMSVSLWSLEQPYSIELVQGSKVNADERMKLVVQAGLYHGHEMLCKMVS
SSEVSVCSEPVWGQRLEFEINVCDLPRMARLCLALYAVVEKAKKARSTKKKSKKADCPIA
WVNVMLFDFRDQLKTGECCLPMWSSFPDEKGELLNPMGTVQTNPNTESAASLVIRFPTIS
SNPLYYPTFEQILEQGKNGQSSFSMVEDPEEKQQLKEILERRSHTDLYEHEKDLVWKMRH
QIRDQFPHALAKLLVVTKWNKHEDVAQMIYLLQSWPELPVLNALELLDFSFPDRYVGAFT
VNSLKKLTDADLFQYLLQLVQVLKYESYLDCELTKFLLGRALSNRKIGHFLFWHLRVRKG
MFPSKRHYEFGLIPGGLPAQGRKVQHGGSGCNRTESLNKMKALNDLIKASSQKNAKPQTK
EFMHTCMRQETYLEALSNLQSPLNPSVILAKVSVELCTFMDSKMKPLWIVFNNEDAGGGH
VGVIFKNGDDLRQDMLTLQMIQLMDILWKKEGLDLRMTPYGCLSTGDKTGLIEVVMDSDT
IANIQLNKSNMAATAAFNKDALLNWLKSKNPGDALDRAIEEFTLSCAGYCVATYVLGIGD
RHSDNIMIRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKF
ERFREYCERAYMILRCHGLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEARR
HFQLKFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctgggatttattgtccggtcgaattttggtccaaagaagccaaccagagcatc
caagtggacttcctcttgcccaccggcatttacttgactctctccgtttcctgcaatgca
accctgggcaccatcaaacagctggtctggcaccatgcccaatgcgagcccttcttccac
atgctcagtgacccagagtcgtacgtcttcacctgcatcaaccagacggccgagcggcaa
gagctggaagacgagcagcggcgcctctgcgacatccagccattcttgccagtcctgcgg
ctcgtggcccgtgaaggcgaccgggtcaaaaagctgatcagttctcagatcagcctcctt
atcggcaaaggtttgcatgagtttgactctctgggagatctggaagtggacgacttccgt
gtcaaaatgcagcacttttgcgaggagagagcggcccggcggcagcagctaagctggaag
gcctggatggaatacagcttcccagtccaactggagcctttggccaatggactgggagga
aggtctctgctccagttccccaataagaacatttttgtcaacgtcaagtttgaaagtgga
ggggaaagttttaccttccagatctcgcccaaggagtaccctgcaacccttatgagctat
gccatcaagaagcaagcgactgttttccgtcaccaaaaaatcaacagccctgaagattat
gctttgcagattaatgggaaatatgaatacctctatggaaaccaccccttgtaccaattc
cagtacatccgcgactgcctctgccgcggcctccttccccacctcaccatggtacacgcc
tcctccatctcggctttgtgggaagagcagaccaatgggatttcctatcctataaaagca
gccagcaaagcacctccagtccctaagaaaaagccaatgtcggtgtctctgtggtccctt
gagcaaccttactctattgagttggtgcagggcagtaaagtgaatgcggacgagcggatg
aagttggtggtccaggcaggcctgtaccatggccatgagatgctctgcaagatggtctcc
agctcggaggtcagcgtctgctcggagccggtgtggggccagaggctggagtttgagatc
aacgtctgcgacttacctcgcatggcacggctctgcctggccctctatgcagttgtggag
aaagccaagaaggcaaggtccaccaaaaagaagtccaagaaagcggactgcccaattgcc
tgggtgaacgtcatgctgtttgatttccgagaccaactgaaaacgggagaatgctgccta
cccatgtggtcatcatttccagatgagaaaggagagctgttgaaccccatgggcacggtc
cagaccaaccccaacaccgagagcgcagcctccttggtcatccggttccccaccatttca
tccaacccactgtattatcccacctttgaacagatactggagcagggaaagaacgggcag
tcttccttctccatggtagaggatccagaggagaagcaacagctgaaggaaatcctggaa
cgcaggtctcacaccgacctctatgaacacgagaaggaccttgtgtggaaaatgaggcac
cagatccgagaccagttcccgcacgccttggcaaagctcttggttgtcaccaagtggaat
aaacacgaagatgttgctcagatgatctatttgctgcagtcctggccagagttgcctgtc
ctcaatgccctggagctgttggatttcagttttcctgatcgctatgtaggagccttcaca
gtcaactcactgaaaaaacttacagatgccgacttgttccaatacctcttgcagctggtc
caggtgctgaaatacgagtcctatttagactgcgaattaaccaagttcctcttgggccgg
gccttatccaaccgcaagattgggcacttcctcttctggcacctcagggtcagaaaaggc
atgtttccatccaaacgccattacgaattcggcctgatccctggagggctacctgctcaa
gggagaaaagttcaacatggaggaagtggatgtaacaggaccgaatccctcaacaagatg
aaggcactcaatgacctcatcaaagccagttcccagaagaatgccaagccccaaaccaag
gagttcatgcacacctgcatgcggcaggagacctacctggaagccctctccaacctccag
tctcccttgaaccccagcgtcattctggccaaagttagcgtggagctatgcactttcatg
gattcgaagatgaagccgctgtggatcgtgtttaataacgaagacgctgggggaggccac
gtgggtgtcatttttaaaaatggagacgaccttcgtcaggatatgttgaccctgcaaatg
atccaactcatggacatcctgtggaagaaagagggcctagacttgcggatgaccccgtac
ggctgcctttcaacaggagacaagaccggattgatagaagtggtcatggactcggacacc
attgccaacatccagctcaacaagagcaatatggccgccacagccgccttcaacaaggat
gccttgttgaattggttgaaatccaagaaccctggtgatgccttggaccgggccattgaa
gagttcacgctttcctgtgctgggtattgtgtggccacctacgttttggggattggagac
cgtcacagcgacaacatcatgatccgagagaatggccagctgtttcacattgattttggc
cacttcttggggaacttcaagaccaagtttgggatcaatcgcgagcgggtccctttcatc
ttgacctatgacttcgttcacgtgatccaacaagggaaaacgaacaacagcgagaagttt
gaacgattcagagagtactgtgaaagggcctacatgatcctccggtgccacggtctgctc
ttcctacacctgtttgccctcatgaaagctgccgggttgcctgagctgagctgctccaaa
gacatccaatacctcaaggactccctggccttgggaaagaccgatgaagaagccaggaga
cacttccagctcaagttcaatgaagctctccgggaaagctggaaaaccaaagtgaactgg
ctggctcacaacgtctccaaagacaaccggcaatag

DBGET integrated database retrieval system