KEGG   Anolis carolinensis (green anole): 100568252Help
Entry
100568252         CDS       T01608                                 

Gene name
pik3cd
Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit delta
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100568252 (pik3cd)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100568252 (pik3cd)
   04370 VEGF signaling pathway
    100568252 (pik3cd)
   04630 Jak-STAT signaling pathway
    100568252 (pik3cd)
   04068 FoxO signaling pathway
    100568252 (pik3cd)
   04070 Phosphatidylinositol signaling system
    100568252 (pik3cd)
   04150 mTOR signaling pathway
    100568252 (pik3cd)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100568252 (pik3cd)
  Cell growth and death
   04210 Apoptosis
    100568252 (pik3cd)
  Cellular commiunity
   04510 Focal adhesion
    100568252 (pik3cd)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100568252 (pik3cd)
  Endocrine system
   04910 Insulin signaling pathway
    100568252 (pik3cd)
   04914 Progesterone-mediated oocyte maturation
    100568252 (pik3cd)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100568252 (pik3cd)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100568252 (pik3cd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
h
AA seq 1047 aa AA seqDB search
MLPGIYCPVEFWSKEANQSIQVDFLLPTGIYLTLSVSCNATLGTIKQLVWHHAQCEPFFH
MLSDPESYVFTCINQTAERQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLISSQISLL
IGKGLHEFDSLGDLEVDDFRVKMQHFCEERAARRQQLSWKAWMEYSFPVQLEPLANGLGG
RSLLQFPNKNIFVNVKFESGGESFTFQISPKEYPATLMSYAIKKQATVFRHQKINSPEDY
ALQINGKYEYLYGNHPLYQFQYIRDCLCRGLLPHLTMVHASSISALWEEQTNGISYPIKA
ASKAPPVPKKKPMSVSLWSLEQPYSIELVQGSKVNADERMKLVVQAGLYHGHEMLCKMVS
SSEVSVCSEPVWGQRLEFEINVCDLPRMARLCLALYAVVEKAKKARSTKKKSKKADCPIA
WVNVMLFDFRDQLKTGECCLPMWSSFPDEKGELLNPMGTVQTNPNTESAASLVIRFPTIS
SNPLYYPTFEQILEQGKNGQSSFSMVEDPEEKQQLKEILERRSHTDLYEHEKDLVWKMRH
QIRDQFPHALAKLLVVTKWNKHEDVAQMIYLLQSWPELPVLNALELLDFSFPDRYVGAFT
VNSLKKLTDADLFQYLLQLVQVLKYESYLDCELTKFLLGRALSNRKIGHFLFWHLRSEMH
VPSVALRFGLILEAYCRGSTFHMKALMKQTESLNKMKALNDLIKASSQKNAKPQTKEFMH
TCMRQETYLEALSNLQSPLNPSVILAKVSVELCTFMDSKMKPLWIVFNNEDAGGGHVGVI
FKNGDDLRQDMLTLQMIQLMDILWKKEGLDLRMTPYGCLSTGDKTGLIEVVMDSDTIANI
QLNKSNMAATAAFNKDALLNWLKSKNPGDALDRAIEEFTLSCAGYCVATYVLGIGDRHSD
NIMIRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFR
EYCERAYMILRCHGLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEARRHFQL
KFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctgggatttattgtccggtcgaattttggtccaaagaagccaaccagagcatc
caagtggacttcctcttgcccaccggcatttacttgactctctccgtttcctgcaatgca
accctgggcaccatcaaacagctggtctggcaccatgcccaatgcgagcccttcttccac
atgctcagtgacccagagtcgtacgtcttcacctgcatcaaccagacggccgagcggcaa
gagctggaagacgagcagcggcgcctctgcgacatccagccattcttgccagtcctgcgg
ctcgtggcccgtgaaggcgaccgggtcaaaaagctgatcagttctcagatcagcctcctt
atcggcaaaggtttgcatgagtttgactctctgggagatctggaagtggacgacttccgt
gtcaaaatgcagcacttttgcgaggagagagcggcccggcggcagcagctaagctggaag
gcctggatggaatacagcttcccagtccaactggagcctttggccaatggactgggagga
aggtctctgctccagttccccaataagaacatttttgtcaacgtcaagtttgaaagtgga
ggggaaagttttaccttccagatctcgcccaaggagtaccctgcaacccttatgagctat
gccatcaagaagcaagcgactgttttccgtcaccaaaaaatcaacagccctgaagattat
gctttgcagattaatgggaaatatgaatacctctatggaaaccaccccttgtaccaattc
cagtacatccgcgactgcctctgccgcggcctccttccccacctcaccatggtacacgcc
tcctccatctcggctttgtgggaagagcagaccaatgggatttcctatcctataaaagca
gccagcaaagcacctccagtccctaagaaaaagccaatgtcggtgtctctgtggtccctt
gagcaaccttactctattgagttggtgcagggcagtaaagtgaatgcggacgagcggatg
aagttggtggtccaggcaggcctgtaccatggccatgagatgctctgcaagatggtctcc
agctcggaggtcagcgtctgctcggagccggtgtggggccagaggctggagtttgagatc
aacgtctgcgacttacctcgcatggcacggctctgcctggccctctatgcagttgtggag
aaagccaagaaggcaaggtccaccaaaaagaagtccaagaaagcggactgcccaattgcc
tgggtgaacgtcatgctgtttgatttccgagaccaactgaaaacgggagaatgctgccta
cccatgtggtcatcatttccagatgagaaaggagagctgttgaaccccatgggcacggtc
cagaccaaccccaacaccgagagcgcagcctccttggtcatccggttccccaccatttca
tccaacccactgtattatcccacctttgaacagatactggagcagggaaagaacgggcag
tcttccttctccatggtagaggatccagaggagaagcaacagctgaaggaaatcctggaa
cgcaggtctcacaccgacctctatgaacacgagaaggaccttgtgtggaaaatgaggcac
cagatccgagaccagttcccgcacgccttggcaaagctcttggttgtcaccaagtggaat
aaacacgaagatgttgctcagatgatctatttgctgcagtcctggccagagttgcctgtc
ctcaatgccctggagctgttggatttcagttttcctgatcgctatgtaggagccttcaca
gtcaactcactgaaaaaacttacagatgccgacttgttccaatacctcttgcagctggtc
caggtgctgaaatacgagtcctatttagactgcgaattaaccaagttcctcttgggccgg
gccttatccaaccgcaagattgggcacttcctcttctggcacctcaggtcagaaatgcat
gttccttctgtcgccttacgattcggcctgatcctggaggcctactgccgaggaagcacc
ttccacatgaaggctctgatgaaacagaccgaatccctcaacaagatgaaggcactcaat
gacctcatcaaagccagttcccagaagaatgccaagccccaaaccaaggagttcatgcac
acctgcatgcggcaggagacctacctggaagccctctccaacctccagtctcccttgaac
cccagcgtcattctggccaaagttagcgtggagctatgcactttcatggattcgaagatg
aagccgctgtggatcgtgtttaataacgaagacgctgggggaggccacgtgggtgtcatt
tttaaaaatggagacgaccttcgtcaggatatgttgaccctgcaaatgatccaactcatg
gacatcctgtggaagaaagagggcctagacttgcggatgaccccgtacggctgcctttca
acaggagacaagaccggattgatagaagtggtcatggactcggacaccattgccaacatc
cagctcaacaagagcaatatggccgccacagccgccttcaacaaggatgccttgttgaat
tggttgaaatccaagaaccctggtgatgccttggaccgggccattgaagagttcacgctt
tcctgtgctgggtattgtgtggccacctacgttttggggattggagaccgtcacagcgac
aacatcatgatccgagagaatggccagctgtttcacattgattttggccacttcttgggg
aacttcaagaccaagtttgggatcaatcgcgagcgggtccctttcatcttgacctatgac
ttcgttcacgtgatccaacaagggaaaacgaacaacagcgagaagtttgaacgattcaga
gagtactgtgaaagggcctacatgatcctccggtgccacggtctgctcttcctacacctg
tttgccctcatgaaagctgccgggttgcctgagctgagctgctccaaagacatccaatac
ctcaaggactccctggccttgggaaagaccgatgaagaagccaggagacacttccagctc
aagttcaatgaagctctccgggaaagctggaaaaccaaagtgaactggctggctcacaac
gtctccaaagacaaccggcaatag

DBGET integrated database retrieval system