KEGG   Anolis carolinensis (green anole): 100568257Help
Entry
100568257         CDS       T01608                                 

Definition
protein-glutamine gamma-glutamyltransferase 4-like
Orthology
K05621  
transglutaminase 4 [EC:2.3.2.13]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100568257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 665 aa AA seqDB search
MIEKLEQRYYIKFCAKLGDSQVETILKFQQAFEDKVIGTTQIKEWLQRRPHISGHSGGPL
KAVGVDFLRKENVCLHHTYDYDNCSLVARRGQLFSMKLSFNRVLNDNDNVILQLSTADSV
FLPDDDERTEYVLNDTGYIYIGSTKSIRGRPWNFGQFEKDILDCCMYLLDKSQLKPNARK
DPVIISRTMSALVNSQDDRGVLYASWSGKYTSGTSPLAWTGSVPILQQYYKTQKSVLFGQ
CWVFSGVLTTVMRCLGIPARSVTNFASAHDTEENLKVDVFLNEKGEKLNNLTKDSVWNFH
VWNDVWMKRPDLPKGFDGWQAIDATPQEVSQGIYQCGPTPISAIKKGEVYLPYDSKFVFA
EVNADKVYWVVKNEGGEEKYIKLREETKVIGKSISTKAVGKNVREDITDQYKYPEESSEE
RKAVETACCYLQSCNLGTLEDPSAQDSVKSDLKLGTEGDQALWPGQPIELNIVVRNDSLG
TWTINFAASCQLESYTGNVEASLATVKQTIKTEGKPVIEIPLKIAADAYMKTLMVVEDEL
LVKINIIADVQETNEKFMEELYFNFEYPPLKVEMAESAKVNEDFTCAFIFKNTLSISLEN
CKLHVEGLGLFTMETFDQGDLAPGRIFKCKIVCAPRKTGLKKIVAKLTSNQIRGITTEKM
ICITK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaaacttgaacaacgctactacattaaattttgtgcaaagcttggtgattcc
caagttgaaaccatcctcaagtttcaacaggccttcgaggacaaagtaataggcaccaca
cagataaaggagtggcttcaaagacggccacacatcagtggacattctggaggtcctctg
aaggctgttggagttgatttcctccgaaaagagaatgtctgtctccatcatacctatgac
tatgacaactgtagcctggttgcgagacggggacagttgttcagtatgaagttgtctttt
aacagagtgctgaatgataatgacaatgtcatcctgcagctcagtactgcggattctgtt
ttcctgcctgatgatgatgaaagaactgagtatgtgctcaatgatactggctatatctat
attggatcaacaaaaagtatacggggaaggccttggaattttggacagtttgagaaagac
atcctggattgctgcatgtaccttctggacaagagccagcttaagccaaatgctagaaaa
gaccctgtcatcatttcccggactatgtcagctttggttaattctcaggacgatcgtgga
gtgctctatgcaagctggtcaggaaaatatacaagtggtacttctcctctggcctggaca
ggaagtgtgccaattttgcaacagtattacaaaacccaaaaaagtgtcctgtttggccag
tgctgggttttctctggagtccttaccacagttatgcgttgtttggggattccagccaga
agtgtgaccaatttcgcatcagcacacgatacagaagaaaatctaaaagttgatgtcttc
ttgaatgaaaagggagaaaaattgaacaatctaacaaaagactctgtttggaacttccac
gtgtggaatgatgtttggatgaaaaggccagatctgccaaagggctttgatggctggcag
gcaattgatgccacacctcaggaagtgagccaagggatttaccagtgtggccctactcca
ataagtgcaataaaaaagggagaagtctatcttccctatgactctaagtttgtgtttgct
gaagtgaatgcagacaaggtctactgggttgtaaagaatgaggggggcgaagaaaaatac
atcaagctgcgcgaagaaaccaaggtgatagggaagagcatcagcaccaaagccgttggg
aagaacgtccgggaagacatcacggatcagtacaaatatccagaagagtcttctgaggaa
aggaaagctgtggaaactgcttgctgctatcttcagtcttgcaatctaggcaccttggaa
gacccatctgcccaggattctgtcaaatctgacttaaaacttgggacggaaggggaccaa
gcactatggcctgggcaacccattgagctgaatattgttgtaaggaacgattctctgggt
acatggaccatcaactttgctgcctcttgccagctggaatcatacactgggaatgtagag
gccagccttgcgaccgtgaagcagacaatcaaaacagaaggcaagccagttattgagatc
cctctgaaaatagcagctgatgcttacatgaagacattgatggtcgtagaggatgaactt
ctggtcaagatcaatattattgcggatgttcaagaaacaaatgagaagttcatggaggaa
ctgtatttcaactttgagtatcccccactcaaagtggagatggcagaaagtgcaaaggtt
aacgaagattttacctgtgcattcattttcaagaacacattgtccatttccctggaaaat
tgcaaactgcatgttgaaggcctgggtctctttacgatggaaacatttgatcaaggggac
ttagcacctggacgaatatttaaatgcaaaatagtgtgtgcaccaaggaagactgggctg
aagaagattgtggccaaactgacatccaaccagattagagggataacaacagaaaagatg
atctgcattaccaagtag

DBGET integrated database retrieval system