KEGG   Aspergillus clavatus: ACLA_001270Help
Entry
ACLA_001270       CDS       T01148                                 

Definition
alkaline phosphatase family protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
act  Aspergillus clavatus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACLA_001270
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ACLA_001270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 623 aa AA seqDB search
MIVIEEREWQLLQQEEKAAAQRDDVKEAQETRATKRSSQSPLKTLLTGVPSRRLPLATRL
TALINVVLALLSLDFLLRGVVLYSGDNLAFTRVGYVSPTTANVLVREPDPAQLPLVLFYQ
EAEQTDPLHWVEEGKIYALDDSTDYTTSVTIRGLKPSSGYRYSLSNNQTGSFVTAPLPGT
ESANRLTFLTSSCIKPNFPYNPLSHSLRIPGIEKMAETVSKLPSLLRPAFMLFLGDFIYI
DVPQRFGSSVWHYRSEYRRIYSSPSWSTPHADAAINLPWIHTLDDHEIANDWSKGNTTAP
YPAAVDPYVHYHVSVNPPIPPLAFAQPENTTYFSFINGPASFFMLDTRTYRSEPSQVNST
MLGSAQLQSLLAYLARPESAEVRWKIVASSVPFTKNWHVGTADTWGGFLHERRTIFEAMW
RAERELGIRIVLLSGDRHEFGATRFPDPTLDFTAEDNRPHTAGEGLHEFSVGPLSMFYLP
IRTYRQTDAEDVAVKYIPDGNVKYGLIHIDAQDEFIDTVSGEPVTVPSSVLTYSLYVDDQ
VVWKYKLSVPLPEAGALMGASSAKHPLLAPGKVLFDGRQGEGWDAALQTVIGRAGEIAGR
FGRRLVDEFYEVLDVAERAERLD
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgatagaagagcgggagtggcagcttctgcaacaagaagagaaggccgctgct
caacgagatgatgtgaaagaagcccaggaaactagagctacaaagcgctcatcccaatct
ccactcaagacactgttgactggcgtgccttcgcgcagattgccgctggcaacacggttg
acagctctgatcaatgtcgtgcttgcgcttctgtcccttgacttcctgctgcgaggtgta
gtgctttactctggggataatcttgctttcacccgtgttgggtatgtctccccgactaca
gcgaatgtcctggtacgcgagcccgatccagcgcagctgcctttggttctcttctaccag
gaagcagagcaaacggatcccttgcactgggtcgaggagggtaaaatctatgcgctcgat
gactccacggattacactacctctgtgactatcagaggcttgaagccgtcttctggctac
cgctactctctgtcgaacaaccaaaccggatccttcgtcacagctcctctgccgggcaca
gaatcagccaaccggctgacattcttaacatcgagctgcatcaaaccgaatttcccgtac
aatccgctctcgcactcgctgcgtatcccggggattgagaagatggctgaaactgtcagc
aaactgccgtccctgctgcgacctgctttcatgttgttcctaggtgacttcatctacatc
gacgtgcctcagcgctttggatcgtctgtgtggcattaccgtagcgagtaccgcagaatc
tactcatctccatcgtggtcgaccccccatgccgatgcggccatcaatcttccctggatt
cacacactcgacgaccacgaaatcgccaatgactggtccaaggggaacaccaccgctccc
taccctgctgctgtggacccctacgtgcattaccatgtcagcgtgaaccctcccatccca
cctctagcgtttgctcaacccgagaacaccacgtacttctcgttcatcaacgggcccgcc
tccttcttcatgctagacacccgcacctaccgctccgagccgtcgcaggtcaactcgacg
atgctggggtccgcccagctgcaatccctcctcgcgtacctcgcccgacccgagtcggcc
gaagtccgctggaaaatcgtcgcgtcgagcgtcccattcaccaagaactggcacgtcggc
accgccgacacctggggcgggttcctgcacgagcgccgcaccatcttcgaagccatgtgg
cgcgccgagcgcgagctcggcatccgcatcgtcctcctcagcggcgaccgccacgagttc
ggcgccacgcgcttccccgacccaaccctcgacttcaccgccgaggacaaccgcccacac
acggccggcgagggcctgcacgaattcagcgtcggcccgctcagcatgttctacctgccc
atccggacataccggcagacggacgccgaagacgtcgcggtcaagtacatcccagacggc
aacgtcaagtacggcctcatccacattgacgcccaggatgaattcatcgacaccgtatcc
ggcgagcctgtgacagtgccgagctctgtcctgacgtactcgctctacgtcgacgaccag
gtcgtctggaagtacaagctcagcgtccccttgcctgaggccggtgcgctcatgggggct
tcctccgcgaagcacccactgctggcgccggggaaggttttgttcgatgggcgccagggt
gaggggtgggatgctgccctccagacggtgatcgggcgggcgggcgagatagcaggcagg
tttgggcggcgactcgtggacgagttctatgaggtgctggatgtagcggagagggcggag
aggttggattga

DBGET integrated database retrieval system