KEGG   Aspergillus clavatus: ACLA_001920Help
Entry
ACLA_001920       CDS       T01148                                 

Definition
ubiquitin C-terminal hydrolase (HAUSP), putative
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
act  Aspergillus clavatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1123 aa AA seqDB search
MDNVADNEMLVDEYEQYHNDRTDDVVVSRSGSEEPEPEPLADDYPAMMARILPKDSDLET
ADEAYHTWHIQDWRKLKKKEHGPVFQCGGFPWRVLFFPYGNQVEYASFYLEHAWEQEPPE
NWYACVQFALVLWNVNDPSIYVSHVATHRFNADEGDWGFTRFCELRRLFNMPWEGRGVPL
VQNDEARVTAYVRVVKDPTGVLWHTFQNYDSKKETGMVGLKNQGATCYLNSLLQSLYFTN
SFRKAVYQIPTEAEASKENSAWTLQRLFYNLQTSENSVSTTELTASFGWESRQIFEQQDV
QELSRKLMERLEEKMKGTPVEKALPDLFVGKTKTYISCINVDYESSRVEDFWDIQLNVRG
NKTLDDSFKDYIQVETLEGENKYDAGSPYGLQDAKKGVIFESFPPVLHLHLKRFEYDINR
DAMMKINDRHAFPMEFDASPYLSNDADKSESYMYELHGVLVHSGDLNAGHYYAFLKPTKD
GHWYRFDDDRVTRATDKEVLEENYGGEYELANGAAGVRQPYTRGLSTKRSMNAYMLVYVR
KTRIDDVLLPITKDDVPSHIEKRLTEERAEFLRRKKEREEAHLFINVGVLTEESYRSHHG
FDLTSTDLPAGDPALPKAYRILRATKVREFAEQLAEERGLNANQIRFWVMVNRQNKTTRP
DQVIKDPDMTVEEAYSRYGTKGNPFKVWMEVGQPAADGSIPSPDSNNSVLIFLKNFDVPS
QTLTGVGAVYVRKNQRVADLAPTILEKMNWPAGTEFMLFEEIKHNMIDVMKPKQTFQQSE
IQDGDIITFQRTVKESELPPAALYTDARQYYDYLLNRIDITFAPFKATDGDEFVLTLSRK
MTYDQFSKKVGEHLNVESTHLRFAPVLASSGKPKQFIKRNSNQANQTLYHILSGQVSGYG
YSMHRQDALYYEVLETSLSDFESKVCLKVTLLPEGITKEQVIEVLVPRDGTISDLLAGLQ
KKANLEDDVVREMRVFEAHSGKIYKEYQADSRIAPINEYVSLYAERVPEEELQMRDGERT
INAFNFDREPNRSHGVPFKFVLRPGEIFKETKERLSKRTGIKGKQFEKIKFAVVPRSLYS
NPRYLEDDDILSDIVGDSDDLLGLDHVNKNRNFWNRSESFFIR
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgttgcggataatgagatgctcgtcgatgaatacgagcagtatcacaatgac
aggacggatgatgtcgtggtctctcgctctggttcagaggagccagaaccagagcccctt
gcggatgactatcccgcaatgatggctcgcatcctcccgaaggattccgacttagagacc
gcagacgaagcgtatcacacatggcacattcaggattggcgcaagctgaaaaagaaggag
catgggccagtcttccaatgtgggggattcccttggcgggtgctcttcttcccttacggt
aatcaagttgaatatgcttcattctacctggagcatgcttgggagcaggaacccccagag
aattggtatgcatgcgtccaatttgctttggttctgtggaacgtcaatgacccatcaatt
tacgtatctcatgttgctacgcaccgttttaacgcagacgagggcgattggggctttacc
agattctgcgaattgcgcagacttttcaacatgccatgggaaggccgtggagtcccgtta
gtgcaaaatgacgaagccagagtcacggcttacgtacgtgttgtgaaagacccgacgggt
gtgctttggcacactttccaaaactatgactcgaagaaggaaactggcatggtcgggttg
aagaaccagggtgcaacatgttacctcaattccttgctccagtccttatacttcacaaac
tcattccgcaaggctgtataccaaatacccacagaggccgaggcgtccaaagaaaacagt
gcctggactcttcaaaggctattctacaaccttcaaaccagtgagaattcggtatcgaca
actgaattgacggcatcattcggctgggaatcgcggcaaatcttcgaacagcaggatgtc
caggaactttcgagaaagttgatggaaaggttggaggaaaagatgaaaggaacgccagtg
gaaaaggcattgcccgacctcttcgttgggaagacgaagacttatatctcctgtattaac
gtcgattatgaatcctcgcgcgtggaggatttctgggatatccagcttaacgtgaggggc
aacaagacccttgacgacagcttcaaggattacatccaggtggaaactcttgaaggcgag
aacaaatacgacgctggttctccctacggtttgcaagatgcaaagaaaggtgtcatcttc
gaaagcttcccccctgtccttcatctccacttgaagcggttcgaatacgacatcaatcgc
gacgcgatgatgaagatcaatgaccgccacgctttccccatggagtttgatgcttcaccc
tatctttccaatgacgccgacaaatcagaatcctatatgtatgagttgcatggagttttg
gtccacagcggcgacttgaacgcaggacactactacgcatttttgaaacccactaaggat
ggacattggtatcgctttgatgatgatcgagttactagagctactgacaaggaggtcctt
gaggagaattatggtggtgaatatgagcttgccaatggcgcggctggcgtacggcaacca
tacacaagaggactttcgacaaagcggtctatgaatgcctatatgttggtatacgttcgc
aagacacgaatagacgatgttctcttaccgattacgaaggatgacgttccttctcacatt
gaaaaacggttgaccgaggaaagagcggagtttctccgcaggaagaaggagagggaggaa
gcgcacctctttatcaacgtcggagttttgacggaagagtcctacagatcgcatcacgga
tttgatctaacaagcacggatctacctgccggcgatcccgccctaccaaaggcgtacagg
atactccgggctacgaaggttcgcgaattcgctgagcagcttgctgaagaacggggtctt
aacgccaatcaaattcgcttctgggtcatggttaaccgccaaaacaagacaactcgccct
gatcaagtcatcaaagaccctgatatgactgtcgaagaagcctatagcagatacggcact
aaaggaaatccattcaaagtatggatggaggttgggcagcctgctgcggatgggtccatt
ccttcgccggatagcaacaactcggtcttaatcttcttgaagaatttcgacgtgccgtcg
caaaccctcacaggagtgggagctgtatatgttcggaagaatcagagagttgccgacctt
gctccgacgatactcgagaagatgaactggcctgccgggaccgaatttatgctttttgag
gagatcaagcacaacatgatcgacgttatgaagccaaagcagacattccagcagtcggag
attcaagatggtgatattataacattccagcggacggttaaagagtccgaattacccccg
gccgcattgtacaccgacgcgagacaatactacgactacttgttgaacaggatcgatatt
accttcgctcccttcaaggctaccgacggtgatgaatttgttctgactttgagccgaaag
atgacatacgatcaattctcaaagaaggttggcgagcatctgaacgtggagtcaacgcac
ctacgctttgctcccgttctggcaagcagtggaaaaccaaagcagttcatcaagcggaac
tccaaccaggccaaccagactctgtatcacattcttagtggacaggtcagcggatatggt
tatagtatgcaccgtcaggatgcgctatattatgaagtcctggagactagcttgagtgac
tttgagtcaaaagtttgcctgaaagtaacattgcttcctgaaggcatcactaaagagcaa
gtaattgaggtcctagtccctcgggacggtaccatctcagatctcctggcgggactgcag
aagaaggccaaccttgaagacgacgtggtccgtgaaatgcgggtcttcgaagctcacagc
ggcaagatctacaaggaatatcaagccgactccaggatcgctcctatcaatgaatatgta
tctctatacgccgaaagagtaccggaggaagaactccagatgcgggacggcgagcggaca
atcaacgcattcaactttgatcgggaaccgaacaggtcacacggagttcctttcaagttt
gtcttgagacctggcgaaatcttcaaggagacgaaagagagattatccaagcggacgggc
atcaaaggcaagcaatttgagaagatcaaatttgctgttgtaccccgatcgttgtactct
aacccgcggtatctcgaagatgatgatatcctttccgacatcgttggtgactccgacgat
ctgctgggactcgaccatgtaaataagaatcggaatttttggaacaggagcgagtccttt
ttcattcgatag

DBGET integrated database retrieval system