KEGG   Aspergillus clavatus: ACLA_001980Help
Entry
ACLA_001980       CDS       T01148                                 

Definition
translation initiation factor eIF4E3, putative
Orthology
K03259  
translation initiation factor 4E
Organism
act  Aspergillus clavatus
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:act03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 343 aa AA seqDB search
MDNANLWTRRANSAKLSLSMTGTDGKDGGARVDLPRGHTTKRFGPDSSHGGRSNPFNALS
PISGGVSSPSTNASSAFGLGSGAFASFGTPKTPGTSASDLNSSKAPGEKREAGSELDSVA
EIKTKAPVSGPRDHALKSTWVIWYRPPTPKYSDYEKSTVPLASISSVESFWSIYSHLKRP
SLLPTVSDYHIFKKGIRPVWEDDANKKGGKWIVRLKKGVADRYWEDLLLAMVGDQFAEAG
DEVCGAVLSVRSGEDVLSVWTRIDGGRNIKIRETIKRLLAFPADTNIVWKSHDDSIAQRS
AIDQARQDKASGNTGHHHHLGGDRRRNMPNDDSIGDKGKGTAS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggataatgcaaacttgtggactcgcagagctaactccgccaaattgtctctgtctatg
acgggaactgacggaaaggacggtggcgcaagagttgacctcccccgcggtcatacaacg
aagcgtttcggtccagatagctcgcacggtggccgatcgaatcccttcaacgcattatcc
cccatctcgggtggcgtgtcctccccgtcgacgaacgcttcctccgcattcggtctgggt
tccggtgcattcgcatccttcggtacccccaagacgcctgggaccagtgcctcggacctg
aattcttccaaagcgcctggtgaaaaacgggaggctggttcggagttggactcggttgcg
gagatcaagaccaaggctcctgtctctggtccccgggatcatgccttgaagtccacttgg
gtgatctggtaccgtccgccgaccccgaaatattcggactatgagaagtccactgtcccg
cttgcatctatatcctcggtggagagcttctggtcgatatactcccatctcaagcgccct
tctctcctccccaccgtgtctgactatcacatcttcaagaaaggcattcgtcctgtatgg
gaggatgatgccaacaagaagggcggaaagtggatcgtccggttgaagaagggagtggct
gaccggtattgggaggatcttctgttggccatggtcggtgatcagttcgccgaggctggg
gatgaagtctgtggcgccgtacttagtgttcggagcggcgaggatgttttgagtgtctgg
acccggatcgacggagggcgcaacatcaagatcagggaaacgatcaaacgcctgcttgcc
ttcccggcggacaccaacatcgtatggaagagccacgatgatagcattgctcagcgctcc
gcaatcgaccaggcccgccaggataaggcttccgggaataccggtcaccatcaccacctc
ggaggggatcgacgaagaaatatgccaaatgacgactctattggagacaagggaaaagga
acggcgtcttga

DBGET integrated database retrieval system