KEGG   Aspergillus clavatus: ACLA_002010Help
Entry
ACLA_002010       CDS       T01148                                 

Definition
GTP cyclohydrolase I, putative
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
act  Aspergillus clavatus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:act00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 335 aa AA seqDB search
MGSGSPPPPGPKPKSAIPSHLLNGSSPLHPSNTTGVRDARERESLNSSIRGSFAPRIPAE
FNLSETETHPVSDAASTYNGAVRSPEIVRPTLSDPPRDPRDEGGALTPPATASRPSSPYT
ANPPIDFDGLSWPCPGTRARLESTPEQTEERIQKLAGAVRTIFECIGEDPEREGLRETPE
RYAKAMLYFTKGYEENVRDLVNGAVFHEDHDELVIVKDIEVFSLCEHHMVPFTGKMHIGY
IPDRRVLGLSKLARLAEMFSRRLQVQERLTKQVALAISEVLKPRGVGVVMESSHLCMVMR
GVQKTSSTTTTSCMLGCMRSSAKTREEFLTLLNRK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgggttccggatctcctcctcccccaggcccaaagcctaagtccgccatcccatctcat
cttttgaatggtagttctcctctgcacccttccaataccactggcgttcgcgatgctcgt
gagcgcgagagcctgaactcatctatccgtggctcctttgcccctcgcattcccgctgag
ttcaacttgtcggaaacagaaacacatcctgtcagcgatgccgccagcacttacaatgga
gctgttcggagccccgaaattgtcaggcctactttgagcgaccccccgcgcgacccccga
gacgaaggtggtgctttgacccctcccgcgacagccagtcggccatcgagcccgtacact
gcgaatccccctatcgatttcgacggattgagctggccttgccctggcacgagggcgcgg
ctggaatccacccctgaacagactgaagaacggatccagaagcttgcaggtgccgtaaga
accatctttgaatgcattggagaggaccctgaaagagagggactgcgcgagactcccgag
agatatgccaaggctatgctttatttcaccaagggctacgaagagaatgttcgcgacctc
gtcaatggtgctgtcttccacgaggatcacgatgagctggtcattgtcaaggacattgag
gtgttctctctctgcgaacatcacatggttccattcactggaaagatgcacatcggatat
atccctgaccgccgagtcctcggtctctcaaagctggcccgcctagcggaaatgttctct
cggagactgcaggtgcaagagcgccttaccaagcaagtcgccttggccatttcggaggtt
ctgaaaccccgaggcgtaggtgtcgtcatggagtcttcccatctctgcatggtcatgcgt
ggtgtacaaaagaccagcagtaccaccaccaccagctgcatgcttggttgcatgcggtcc
agcgcgaagaccagagaagagttccttacacttctcaacagaaagtag

DBGET integrated database retrieval system