KEGG   Aspergillus clavatus: ACLA_002010Help
Entry
ACLA_002010       CDS       T01148                                 

Definition
(RefSeq) GTP cyclohydrolase I, putative
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
act  Aspergillus clavatus
Pathway
act00790  Folate biosynthesis
act01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACLA_002010
Enzymes [BR:act01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ACLA_002010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 4708568
NCBI-ProteinID: XP_001276216
UniProt: A1C522
AA seq 335 aa AA seqDB search
MGSGSPPPPGPKPKSAIPSHLLNGSSPLHPSNTTGVRDARERESLNSSIRGSFAPRIPAE
FNLSETETHPVSDAASTYNGAVRSPEIVRPTLSDPPRDPRDEGGALTPPATASRPSSPYT
ANPPIDFDGLSWPCPGTRARLESTPEQTEERIQKLAGAVRTIFECIGEDPEREGLRETPE
RYAKAMLYFTKGYEENVRDLVNGAVFHEDHDELVIVKDIEVFSLCEHHMVPFTGKMHIGY
IPDRRVLGLSKLARLAEMFSRRLQVQERLTKQVALAISEVLKPRGVGVVMESSHLCMVMR
GVQKTSSTTTTSCMLGCMRSSAKTREEFLTLLNRK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgggttccggatctcctcctcccccaggcccaaagcctaagtccgccatcccatctcat
cttttgaatggtagttctcctctgcacccttccaataccactggcgttcgcgatgctcgt
gagcgcgagagcctgaactcatctatccgtggctcctttgcccctcgcattcccgctgag
ttcaacttgtcggaaacagaaacacatcctgtcagcgatgccgccagcacttacaatgga
gctgttcggagccccgaaattgtcaggcctactttgagcgaccccccgcgcgacccccga
gacgaaggtggtgctttgacccctcccgcgacagccagtcggccatcgagcccgtacact
gcgaatccccctatcgatttcgacggattgagctggccttgccctggcacgagggcgcgg
ctggaatccacccctgaacagactgaagaacggatccagaagcttgcaggtgccgtaaga
accatctttgaatgcattggagaggaccctgaaagagagggactgcgcgagactcccgag
agatatgccaaggctatgctttatttcaccaagggctacgaagagaatgttcgcgacctc
gtcaatggtgctgtcttccacgaggatcacgatgagctggtcattgtcaaggacattgag
gtgttctctctctgcgaacatcacatggttccattcactggaaagatgcacatcggatat
atccctgaccgccgagtcctcggtctctcaaagctggcccgcctagcggaaatgttctct
cggagactgcaggtgcaagagcgccttaccaagcaagtcgccttggccatttcggaggtt
ctgaaaccccgaggcgtaggtgtcgtcatggagtcttcccatctctgcatggtcatgcgt
ggtgtacaaaagaccagcagtaccaccaccaccagctgcatgcttggttgcatgcggtcc
agcgcgaagaccagagaagagttccttacacttctcaacagaaagtag

DBGET integrated database retrieval system