KEGG   Aspergillus clavatus: ACLA_002220Help
Entry
ACLA_002220       CDS       T01148                                 

Definition
lysophospholipase, putative
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ACLA_002220
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     ACLA_002220
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     ACLA_002220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 556 aa AA seqDB search
MAGSDTVIPELLEQQPEDTTPESRVLIIMTGGTICMKQSSSGFVPARGFQEQCLARVPTF
NDGSTSTVMDVVVNAAAEVKAHDSLRTPQTAYGRRVRYTVFEFEELLDSSSIDAKGWTEI
ARTIERNYTLFDAFVVLHGTDSLAYTCSALSFMLQNLGKTVVLTGAQAPMLELQNDATDN
LLGSLVVAGHFMIPEVCLYFNNKLFRGNRSTKVAASDFAAFDSPNCAPLAVTTSMRTSVN
WELVNRPRSLKHFSIQTNLDTACVACLRIFPGIKPEMVDAVLRLEGLRGLVLETFGAGNA
PHGQDNAMTNVLADAIKRGIVIVNVTQCLTGSVSPVYAPGMSLSRAGVIAGLDMTTEAAL
TKLAYLLGFPDATSESVTKAMSVSIRGELTEVSQPLFRHPDGALPERVQTLTMLGYAIAQ
GDFERVQEIFKIEHHWILNDADYSGNTPIHLAANSPSIEILRFLLLQGGSVHIRNRTGRT
PLFLAANAGLSEHVLLLRRSGAHLHAEELPAAELLARRRPGVWGLAGIGPREIIQREMEE
EEHEEAISRVMAGSAP
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcgggttccgacacagtcatccccgagctgttggagcagcagccggaggacacgacc
cccgaatcccgggttctgatcatcatgaccggcggcacgatctgtatgaagcagtcgtcg
tcggggtttgtacccgcccggggcttccaggagcaatgtctggcgcgcgtacctaccttc
aacgatggttcgacctccacggtgatggacgtggtggtcaacgcggcggcggaggtcaag
gcccacgacagcctgcgcacgccgcagacggcctacgggcggcgggtgcggtacacggtc
ttcgagttcgaggagctcctggacagcagctccatcgacgcgaagggctggacggagatc
gcgcgcacgatcgagcgcaactacacgctgttcgacgcgttcgtcgtgctgcacggcacc
gacagcctggcgtatacgtgctcggcgctgagcttcatgctgcagaatctgggcaagacg
gtcgtgctgacgggcgcgcaggcgcccatgctcgagctccagaacgacgccacggataac
ctgctggggtcgctggttgtggctggccactttatgatccccgaggtgtgtctgtatttc
aacaacaagctgttccgcgggaaccggtcgaccaaggtcgctgcgagtgactttgcggcg
ttcgattcgcccaactgtgcgccgctggcggtcacgacatcgatgcgcaccagtgtcaat
tgggagctggtcaaccggcccagaagcctcaagcattttagcatccagaccaatctggac
acggcgtgcgtggcatgtctgcgcatcttccctgggattaagccggagatggtggacgcc
gtgctgcggctggaggggcttcgcgggctagtgctggagacctttggcgctggaaacgcg
ccgcatggtcaggacaatgccatgaccaacgtgcttgccgatgccatcaagagggggatc
gtgatcgtcaatgtcacccaatgcttgactggcagtgtgagccccgtatacgcgccgggg
atgagcctgtcccgggcgggcgtgattgcaggcctggacatgaccaccgaagccgctctg
acgaagctggcctacctgctcggctttcctgacgccacatccgagtccgtgaccaaggcc
atgtcggtgtcgattcgcggggagctgaccgaggtgtcgcagcctctcttccggcacccg
gacggtgcactcccggagcgcgtgcaaacgctcacgatgctgggatacgcgatcgcgcag
ggcgactttgaacgggtgcaggagatcttcaagatcgagcaccactggatcctgaacgac
gcggattactcgggaaacactccgatccacctcgccgccaactcgccatcgattgagatc
ctccgcttcctcctgctgcagggaggatcggtgcatatccgcaaccgcaccgggcgcaca
ccgttattcctggcagccaacgccgggctgtcggagcatgtcctgctgctgcgcaggtca
ggtgcgcatctccatgcggaggagctacccgccgcggagctgctggcgcgccgcagaccg
ggagtctgggggctagctgggattgggccgagggagatcatacagcgggagatggaagag
gaggaacatgaggaggcgatcagccgggtgatggctgggtctgccccttga

DBGET integrated database retrieval system