KEGG   Aspergillus clavatus: ACLA_002630Help
Entry
ACLA_002630       CDS       T01148                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
act  Aspergillus clavatus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ACLA_002630
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ACLA_002630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 387 aa AA seqDB search
MAPLIRVIGSLNADMVSVTPRFPDPGETITASSYFISAGGKGANQAVACGRLSRRKPSTA
AGATRTSSEDAADVKVEMVGAVGALDGHFGALLKPTLEKSGVATARVREVEGAYTGVAVI
IVDSSAGGENRILFSPGANYQGMRATAEVVGMGLAAPVPDVIVMQGEIPVETVIGILRDI
AAWKARNRAAGKRGVEAGPDVMFNPAPAPPGGLPEDVYAAVDHLIMNETEAELMSPPVEQ
LLKVVPGAEGADGNEKVARYFHQLGVTYVLITLGSKGVWYSATDAGTSGPVDGVRRFAKL
IPAAKVSKVLDTTAAGDTFGGAYAVEVARWRESRRAEGKAGLDVAAEEKVSRYQDFMDHA
LGLATRASARCVERQGAMDSIPWEDEI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgttaatccgcgtcatcggctccctcaacgccgacatggtctccgtgacccca
cgcttcccagaccccggcgaaacaatcaccgcatcgtcatacttcatcagcgccggcggg
aaaggcgccaaccaggccgtcgcctgcggccggctatcgcggcggaagccctccacggcc
gctggcgcgacacgcacaagcagcgaggacgccgccgatgtgaaggtggagatggtgggc
gcggtgggcgcgctagacgggcacttcggagcgctcctgaagccgacgctggagaagtcc
ggtgttgcgacggcgcgggtgcgggaggtcgagggggcgtatacgggggtggcggtgatc
atcgtggactcgtctgcgggcggcgagaatcggattctgttctcgccgggggcgaattac
caggggatgcgggcgacggcggaggtggtggggatggggcttgcggcgccggtgccggat
gtgattgtcatgcagggagagattcctgttgagacggtgattgggattctacgggacatt
gcagcgtggaaggcgaggaatcgggcggcggggaagaggggggttgaggccgggccggat
gtgatgttcaacccggcgccggcgccgccgggcggtctgccagaggatgtgtatgctgct
gtggaccatttgattatgaatgagaccgaggcggagttgatgagtccgccagttgagcag
ttgctcaaggttgttcctggagcggagggagcggatgggaatgagaaggtggctcggtac
ttccaccagctgggggtgacatatgttctgatcacgctggggtccaagggcgtctggtac
agtgcgacggatgccggaacctccgggcctgtggatggcgtgaggaggtttgcgaagctg
attccggccgcaaaggtcagcaaggtgttagataccacggcggccggggatacgtttggg
ggcgcatatgctgttgaggtggcgcgatggcgcgagtcacgacgagccgagggcaaagct
ggactggatgtggctgcagaggaaaaagtgtcgcgatatcaggactttatggaccatgct
ctgggtctggcaactcgtgcatctgctcgctgcgtggagcgacagggagcgatggacagc
attccgtgggaggacgagatatga

DBGET integrated database retrieval system