KEGG   Aspergillus clavatus: ACLA_002680Help
Entry
ACLA_002680       CDS       T01148                                 

Definition
glycogen synthase Gsy1, putative
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
act  Aspergillus clavatus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACLA_002680
Enzymes [BR:act01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     ACLA_002680
Glycosyltransferases [BR:act01003]
 Polysaccharide
  Storage polysaccharide
   ACLA_002680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 713 aa AA seqDB search
MASEDTGPDTPKRDVRNHILFEIATEVANRVGGIYSVLKSKAPVTTAEYGDRYTLIGPLN
RASADVEVEELTPSNPRMVETMNSMKERGIEMVYGRWLIEGAPRVLLIDTSTGYKYLDEW
KGDLWNTSGIPSPASDAETNEAIVFGYLVAWFLGEFIAHERRRAVVAHFHEWLAGVALPL
TKKRHMDLTTIFTTHATLLGRYLCAGSVDFYNNLQHFDVDAEAGKRGIYHRYCIERAAAH
SADVFTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFSAVHEFQNLHSQSKEKINDFVRG
HFYGHNDFDLDNTLYVFTAGRYEFRNKGVDMFIESLARLNHRLKASGSKTTVVAFVIMPA
QTSSLTVEALKGQAVVKSLRDTIEMMEKGIGKRMYERCLAWKEGDNMPDEKDLITSQDRV
LLRRRLFAMKRHGLPPIVTHNMLNDSEDPILNQIRRVQLFNYPTDRVKIVFHPEFLNSSN
PVLPLDYDDFVRGTHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSA
DYGIYIVDRRMKGVDDSVNQLTDFMFNFTQKSRRQRINQRNRTERLSDLLDWKRMGMEYV
KARQLALRRAYPSSFDGTEDYYDVIGGTEQKLSRPLSVPGSPRDRSGVMTPGDFATIQEV
KEGLSTEDYIAWRLPNSEEEEPDDHYFPLTLRTKKASDRPSSPLDSISINGGR
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgaggatactggtccggatacccccaagagagatgtgcgcaaccacatcctc
tttgagattgctaccgaagtcgccaaccgcgtcggtggcatctactccgtcctcaaatcc
aaagctcccgtaaccacggccgaatatggcgaccgatacacgctcatcggaccgctgaac
cgggcttccgccgatgtggaggtcgaggagttgactccctcgaacccccgcatggtggag
accatgaactccatgaaggagcgcggcatcgagatggtgtatggtcgctggctgatcgag
ggagctccccgagtccttctcattgacaccagcaccggatacaagtatttggatgagtgg
aagggagacctgtggaacacttccggtatcccgtctcctgcgtccgatgccgagacgaac
gaagcgatcgtctttggttacctggtcgcatggttcttgggagagtttatcgcccatgaa
cgacgacgcgccgtcgtcgcccatttccacgagtggttggctggtgtcgctctcccgctg
accaagaagcgccatatggacttgaccaccatcttcacaacccatgcgacactgctcggc
cggtacctgtgcgcgggctcggtcgacttttacaacaacctgcagcacttcgacgtcgac
gccgaggcgggaaagcgaggcatctaccaccgatactgcatcgagagagcggcggcccat
agcgccgacgtcttcaccaccgtgtcgcacatcaccgcgttcgagagtgagcatctgctc
aagcggaagccggacggggtgctgcccaacgggttgaatgttaagaagttctccgcggtg
cacgagttccagaatctgcactcccaatccaaggagaagatcaatgactttgttcggggt
cacttctatggccacaacgactttgatctggacaataccctctatgtcttcacggccggt
cggtatgagttccggaacaaaggcgtcgacatgttcatcgagagtttggcccgcctcaac
caccgcttgaaagccagcggatcgaagaccacggtggtcgcctttgtgatcatgcccgcg
cagacctcctcgctgaccgtggaggcgctcaagggccaggccgtcgtcaagtccttgcgg
gacaccatcgagatgatggaaaagggcatcggcaagcggatgtacgagcgttgcttggct
tggaaagagggcgacaacatgcccgatgagaaggatttgatcaccagccaggaccgtgtg
ctgttgcgccgccgcctgttcgccatgaagcgtcatggtctgcctccgatcgtgacccac
aacatgctcaatgatagtgaagacccgattctgaaccaaatccgccgggtccagctcttc
aactacccgaccgatcgcgtcaagatcgtgttccatcccgagttcctgaactcttccaac
cccgtcttgcccttggattacgatgactttgtccggggtacccatctcggcgttttcccc
tcctactatgagccctggggctacacccccgccgagtgtaccgtgatgggcgtccccagc
atcaccaccaatctctccggctttggctgctacatggaagagttgatcgagaactcggcc
gactacggaatttacatcgtggatcgtcgtatgaagggcgtcgatgactcggtcaaccaa
ctgaccgacttcatgttcaacttcacccagaagagccgccggcagcggatcaaccagcgg
aatcgcacggaacggttgagcgatctcctggactggaagaggatgggaatggagtatgtc
aaagccagacagttggctctcagaagagcttatccttcatcctttgatggcaccgaggac
tactacgatgtcattggaggaacggaacagaagctctcgcggcccctgtccgtgcctggg
tctccccgcgatcggtccggcgtgatgactcccggtgattttgcaacgatccaggaagtc
aaggaagggctgagcacggaagactacattgcctggcgtctacctaacagcgaggaggaa
gagcccgatgaccattacttcccgttgactctgcggactaagaaggcttcggatcgacct
tcgtcgccgctggatagcatctcgatcaacggtggccgttga

DBGET integrated database retrieval system