KEGG   Aspergillus clavatus: ACLA_003280Help
Entry
ACLA_003280       CDS       T01148                                 

Definition
histone deacetylase hda1
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     ACLA_003280
Protein phosphatases and associated proteins [BR:act01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ACLA_003280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 805 aa AA seqDB search
MEQDGDTVMGEAGPHQSNPGASHAFPSSNPSRPAVPGTLKGGTDPWLAPLLLGNSMNLPL
PVHQSGNPQATAPAAAHQPVGPASVVEKPAESSAAAPVVPAPTKRADSLVEETSDWSEED
LGARVGLPLASLPSGLCYDVQMRYHCEVRPTADVHPEDPRRIYYIYKELCRAGLVDDPES
SRPLVARPLKRIHARNATEEEVSLVHTPDHFAFVESTKDMSDDELIALEHTRDSIYFNKL
TFASALLSTGGAIETCLAVATRKVKNAIAVIRPPGHHAEHDKTMGFCLFNNVSVAARVCQ
KQLGESCRKILIVDWDVHHGNGIQKAFYDDPNVLYISLHVYQDGKYYPGGDEGDWDHCGA
GAGLGRNVNIPWPSQGMGDGDYMYAFQQVVMPIAQEFNPDLVIVASGFDAAAGDELGGCF
VTPPCYAHMTHMLMTLANGKVAVCLEGGYNFRSISKSALAVTKTLMGDPPDRLHSTLPSD
LATSTVRRVMMIQSRYWRCMYPKGPQEEGLWTDRLHDVIRTYQSKQLYDNYKLTSLYIYR
TSISKSFENQVLASSNYYQANPLIVIFHDPPEIMGLPHPVTNKLEAHNCWVADVMKDYIG
WAVGKGYAVIDVNIPKHVTAEPATGKYEGEDENRPTATEELAGYLWDNYIEPNDATEIFL
VGIGNAFYGVANLLINRDTLYKRINGVISFVAENPVRAIASHTQVWLSRWYKDNSLVYVS
HTHGVWNNVESRRKPSKRYGHLIQSPKAGLSEMLMHHKNEVFKWIEDRADEAVTEEEEDA
RKGKSKSKSRSPTKEKPAGVPPGPS
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggatggagacacggtgatgggagaggctggcccccatcaatccaatcctggt
gcttcacatgcctttccttctagcaatcctagcagacctgctgttccaggaaccctcaag
ggaggcacagacccgtggctcgctccgctgcttttggggaattcgatgaatctgcccctg
cctgttcatcagtcggggaatccacaggcgactgcaccggctgcagctcaccagcctgta
ggaccggccagcgttgtggagaagccagccgaatctagcgctgctgctcctgtggttcct
gcgccaaccaaacgtgcagatagtctcgtcgaggagacttcggactggtctgaagaagac
ttgggggcccgtgtgggtcttccgcttgcatctttgccgtctgggttgtgctatgatgtg
caaatgcgctatcattgcgaggtgcggccgactgcagatgtccatccggaagatcccagg
cggatctactatatctacaaggagctatgccgagcaggccttgttgatgacccggaatcg
tcgaggccgcttgtcgcgcgtccattgaagcggatccatgcccgcaatgctaccgaggag
gaggtctctctcgtccacacgccggatcattttgctttcgtggaaagtacaaaagatatg
tctgacgacgaactgatcgccctggaacatacgcgagactcgatctacttcaataaattg
acgtttgcgtcggcccttctgtcaacgggtggagccattgagacctgtctggccgtggcg
actcgtaaagtgaagaatgccattgctgtcattcggcctcccgggcaccatgcagaacat
gacaaaaccatggggttctgtctcttcaacaatgtttccgtggcggcgcgcgtttgtcag
aagcagcttggggaaagttgccgaaagatattgattgtcgactgggatgtccaccacggt
aacggtattcagaaagcgttttatgatgaccccaacgtcttgtacatctcgctccacgtc
tatcaagacgggaagtactatcccggaggcgatgaaggtgactgggaccactgcggagct
ggtgcaggtcttggaaggaacgtcaatattccgtggcctagccagggcatgggtgatggt
gattacatgtacgctttccaacaggttgtcatgcccattgcccaagagttcaaccctgat
ctggtgattgttgcctctggcttcgatgccgctgctggcgatgagctcggaggttgcttc
gtaacaccgccctgctatgctcacatgacgcatatgctcatgaccctcgccaatggcaaa
gtcgcagtctgtttagaggggggctacaatttcagatccatctccaaatccgcccttgcc
gtgacaaagacgctcatgggggatccaccagaccgattacactcgacgctcccgtcggat
cttgctacttcgactgtcaggcgtgtgatgatgatccaatctcgctactggcgctgcatg
tacccgaaaggaccacaggaagagggactgtggaccgatagactgcatgatgttattcgt
acctatcaatcgaagcaattatacgacaactacaaacttacctcactttacatctatcgg
acgagcatctccaagtcgtttgagaatcaggtgttggcaagctccaattattatcaggct
aacccattgattgtcatctttcatgacccgccggaaatcatgggcttgcctcatccggtc
accaataagctcgaggctcataattgctgggtcgctgatgtcatgaaggattatattgga
tgggcggtcggaaagggatacgctgtgattgatgtcaacattcccaagcatgtgacggcc
gagcctgcgactggaaagtatgaaggcgaggacgaaaaccggcccacggccaccgaggag
ctggctggatatctgtgggacaactacattgagcccaacgatgcaaccgagattttcctt
gtcggcatcggcaacgctttctacggagtcgcgaacctgttgattaacagagatacgctg
tacaaacggatcaacggtgttatttcttttgtcgccgagaaccctgttcgggcgatcgcc
tcgcacacgcaggtttggctctcgcggtggtataaagataactccctggtctatgtttcg
catacccacggtgtctggaacaatgtcgagtctcgacggaagccatcgaagcgctacggt
cacctcatccagtcacccaaggcgggactcagcgagatgctgatgcaccacaaaaacgaa
gtattcaagtggatcgaagacagggccgacgaggctgtgacggaggaagaggaagacgcg
agaaagggcaagagtaaaagcaagagccggtcgccgaccaaggagaagccggctggggtt
cctcctggcccgagctga

DBGET integrated database retrieval system