KEGG   Aspergillus clavatus: ACLA_007420Help
Entry
ACLA_007420       CDS       T01148                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
act  Aspergillus clavatus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACLA_007420
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACLA_007420
   00020 Citrate cycle (TCA cycle)
    ACLA_007420
   00620 Pyruvate metabolism
    ACLA_007420
Enzymes [BR:act01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ACLA_007420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 851 aa AA seqDB search
MVASAVRMRVPSAMLSKGALCMRRPQVVHRFKDAVQPQLPALAALSRFYASKSFPPHTII
SMPALSPTMSAGNIGAWQKKAGDSLVPGDVLVEIETDKAQMDFEFQEEGVLAKVLKETGE
KDVAVGAPIAVLVEEGTDVSSFESFSLEDAGGDKGAAPAKETKEEPKADAAPAATPEPAP
EAYEPETSADKLQPSLDREPSISPAAKALALEKGVPVKALKGTGRGGQITKEDVEKYKPS
TSAAAAGPTYEDIPLTSMRKTIASRLQQSVRENPHFFVSTTLSVTKLLKLRQALNASSEG
KYKLSVNDFLVKACAAALLKVPAVNSSWREENGQVVIRQHNAVDISVAVATPSGLITPVV
KDVQGLGLSSISNQIKDLGKRARENKLKPEEYQGGTFTISNMGMNPAVERFTAVINPPQA
GILAVGTTRKVAVPVETEEGTSVEWDDQIVVTGSFDHKVVDGAIGAEWIKELKKVVENPL
ELLLRAPNPTRTYLNETAESTASLVDVDSPHVVSVDSDFLNQEVKTTTQAERLEREAREE
EERKERERAVEAEKAKAKAARAGHVAKRNPVFVGNAIIYTLVGAALGYGAYRKHLEGRLS
WKLVGAWSGVVGAFGAVDYFVSNEVACHKSVLSHPNENISASQIAASLASLSRTIDDYSA
LSKKELIPAKQEKAFERVKNFRAELADYRTHFDRLRKEREEAQSVTNRNELLGRRPHHAA
TPENPYAQSSLPQSSPFANASSSRSGLSFGASPADFNRETHALREQSFFANTNTQLDEFL
DRGRAVLADLGQQREVLKGTQRRLYSVANTLGISGDTIRRVERRAKQDKWIFWGGVLTFF
LFCWAVLHFLR
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggttgcctctgctgtccggatgcgcgtccccagcgctatgttgtccaaaggcgctctc
tgtatgaggcggcctcaggttgttcacagattcaaggatgctgtccaacctcaattgcct
gccttggccgctctttcccgcttctatgcctccaaatccttcccccctcacactatcatc
agcatgcctgctttgtcgccgaccatgtccgcgggtaatatcggagcctggcagaagaag
gctggcgacagtctggtgcccggtgatgttttggttgagatcgagactgataaggcgcaa
atggattttgagtttcaagaggagggtgtcctggccaaggtcctgaaggagactggtgag
aaggatgtggctgttggtgctcctatcgccgttctcgtggaggagggaacagatgtttcc
tcttttgagagtttctccttggaggatgccggtggcgataagggagctgctcctgccaag
gagactaaggaagagcccaaggctgatgctgctcctgcagcaaccccggagcccgcccct
gaggcctatgagcctgagacatcggcggacaagctgcagcccagtcttgaccgtgagcct
agcatcagccctgctgccaaggcgttggccttggagaagggcgttccagtcaaggctctc
aagggcactggccgtggtggtcagatcaccaaggaggatgtcgagaagtacaagcccagc
acttccgccgccgccgccggacctacatacgaagatatccctctcacatccatgcgcaag
actattgcctcgcgtctgcagcagtcggtgagagagaaccctcacttcttcgtttccacc
accttgtcggtcaccaagctcctgaagcttcgtcaggccctcaacgcctcttccgagggc
aagtacaagctctccgtcaatgacttccttgtcaaggcctgcgccgctgccctcctcaag
gttcctgccgtcaactccagctggcgtgaggagaacggccaggttgtcatccgccaacat
aacgctgttgatatcagtgtcgctgtcgctaccccctccggcctgatcacccctgttgtg
aaagatgtccagggtcttggcctttctagcatctccaaccagatcaaggatctcggtaag
cgcgctcgcgagaacaagctcaagcccgaagagtaccagggtggcactttcaccatcagc
aacatgggcatgaaccctgctgttgagagattcaccgctgttatcaaccctcctcaggcc
ggtatcctggctgttggaaccacgcgcaaggttgctgttccggttgagaccgaggagggc
acgtctgttgagtgggatgaccagattgttgtaactggcagctttgaccacaaggttgtc
gatggtgctatcggtgctgagtggatcaaggagctgaagaaggttgttgagaaccccttg
gagcttcttctccgcgctcctaacccaacccgcacctacctgaacgaaacagcagagagc
accgcctccctggttgacgtcgactcccctcatgttgtctcagtagactcggacttcctg
aaccaggaagtgaagaccaccacccaggccgagcggttggagcgggaggctcgcgaggaa
gaggagcggaaagagcgcgagagggccgtggaggctgagaaagcgaaagccaaagccgcg
cgtgctggtcacgttgcgaagcgcaaccctgtctttgttggaaatgccatcatctatacg
ctggtcggcgcagcgctcggatatggcgcatacagaaagcatctcgaaggcagactctca
tggaagctggttggcgcctggtctggtgttgtcggggcctttggtgcagtggattacttc
gttagcaatgaggtcgcctgccacaaatcggtcctttcccatcctaatgagaatatctct
gcaagccagatcgcagcttcactggcatcattatcacggacgatcgatgactactcggct
ctgtcgaagaaggaactgatccccgcgaaacaagaaaaggcgtttgaaagagtcaagaat
ttccgggcagaactcgcggactacaggacgcatttcgatcggttgcgaaaagagcgcgag
gaggctcaatcggtcacaaatcgtaatgagcttcttggtcgacgaccacaccatgctgct
acccccgaaaatccctatgctcaatcgtccctcccgcagtcttctcccttcgcaaacgcc
tcatcgtcccgctccggtctcagctttggtgcttcgccagccgatttcaatcgtgaaacg
catgcgctccgtgaacagtccttttttgccaatacaaatacgcagttggatgaattcctt
gaccggggtcgggccgttcttgcggatctaggacagcaacgcgaggttctcaagggtact
cagcgtcgattatacagcgttgcgaataccctggggataagtggtgatactattcggaga
gtcgaacggagagcaaagcaggacaagtggatattctggggcggtgttctgaccttcttc
ctcttttgctgggcggtgctacactttttgaggtga

DBGET integrated database retrieval system