KEGG   Aspergillus clavatus: ACLA_008860Help
Entry
ACLA_008860       CDS       T01148                                 

Definition
inosine triphosphate pyrophosphatase (itpase) (inosine triphosphatase)
Orthology
K01519  
inosine triphosphate pyrophosphatase [EC:3.6.1.19]
Organism
act  Aspergillus clavatus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:act00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:act00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 186 aa AA seqDB search
MAVISNLNFITGNKNKLAEVRAILGNVVVVESQAIDVPEIQGTIEEIAKEKSRRAAEVVG
GPVLTEDTALEFRALKGLPGPYIKDFLGALGLEGLNKMLDSFEDKTAEAVCTFAFCRGPG
EAPMLFQGRTEGKIVRARGPSTFGWDPIFEYNGKTYAEMAKEEKNQVSHRSKALAKLQCW
LAEGQI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcatatcgaatcttaacttcatcactggcaacaaaaacaaactggctgaggtc
agagcgatactaggaaatgtagttgtggtggagagccaggcaatcgatgtgcctgagata
caagggaccatcgaggagatcgccaaggaaaagtctagacgcgcagcagaagtggtagga
ggtccagttttgacagaagatacggcacttgagtttcgggcactaaagggacttcctgga
ccctacatcaaggatttccttggtgcactagggctcgaaggattgaacaaaatgctcgac
tcctttgaggacaaaacagcggaagctgtttgtaccttcgctttttgtcgcggtcctggg
gaagcaccaatgcttttccaaggtagaaccgagggaaagattgtgcgggccagaggcccg
tcgactttcggttgggatccgatctttgaatacaatgggaagacctatgcagagatggcc
aaagaggagaagaatcaagtctctcacaggtccaaagctctcgccaagctacagtgttgg
ttggcggagggacaaatttag

DBGET integrated database retrieval system