KEGG   Aspergillus clavatus: ACLA_008860Help
Entry
ACLA_008860       CDS       T01148                                 

Definition
inosine triphosphate pyrophosphatase (itpase) (inosine triphosphatase)
Orthology
K01519  
inosine triphosphate pyrophosphatase [EC:3.6.1.19]
Organism
act  Aspergillus clavatus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ACLA_008860
   00240 Pyrimidine metabolism
    ACLA_008860
Enzymes [BR:act01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.19  nucleoside-triphosphate diphosphatase
     ACLA_008860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 186 aa AA seqDB search
MAVISNLNFITGNKNKLAEVRAILGNVVVVESQAIDVPEIQGTIEEIAKEKSRRAAEVVG
GPVLTEDTALEFRALKGLPGPYIKDFLGALGLEGLNKMLDSFEDKTAEAVCTFAFCRGPG
EAPMLFQGRTEGKIVRARGPSTFGWDPIFEYNGKTYAEMAKEEKNQVSHRSKALAKLQCW
LAEGQI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcatatcgaatcttaacttcatcactggcaacaaaaacaaactggctgaggtc
agagcgatactaggaaatgtagttgtggtggagagccaggcaatcgatgtgcctgagata
caagggaccatcgaggagatcgccaaggaaaagtctagacgcgcagcagaagtggtagga
ggtccagttttgacagaagatacggcacttgagtttcgggcactaaagggacttcctgga
ccctacatcaaggatttccttggtgcactagggctcgaaggattgaacaaaatgctcgac
tcctttgaggacaaaacagcggaagctgtttgtaccttcgctttttgtcgcggtcctggg
gaagcaccaatgcttttccaaggtagaaccgagggaaagattgtgcgggccagaggcccg
tcgactttcggttgggatccgatctttgaatacaatgggaagacctatgcagagatggcc
aaagaggagaagaatcaagtctctcacaggtccaaagctctcgccaagctacagtgttgg
ttggcggagggacaaatttag

DBGET integrated database retrieval system