KEGG   Aspergillus clavatus: ACLA_009270Help
Entry
ACLA_009270       CDS       T01148                                 

Definition
SET and WW domain protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
act  Aspergillus clavatus
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:act00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 968 aa AA seqDB search
MPSHDNADSPSASVTNAVTAMKLEQNDGAAETPVLNGGDAIAKQESYGLSSPPTATRDHS
ELSGMSSSAVKSRASSQSPVKIENGDTPEMEEKVGGDITVKMEPGQPPKLTRTTSQKVAA
RPPQLFLHLPDGTAEAQSTFEVMETCTYANKYMGYTEHAMECDCAEEWDQSAGKNLACGE
DSDCINRATKIECVGDCSCGANCQNQRFQRREYANVAVIKTEKKGFGLRAETDLQPHQFI
FEYVGEVINEGHFRRRMRQYDEEGIKHFYFMSLSKGEFVDATKKGNLGRFCNHSCNPNCY
VDKWVVGEKLRMGIFAERAIRAGEELVFNYNVDRYGADPQPCYCGEPNCTGFIGGKTQTE
RATKLSNATIEALGIEDADSWDTAVAKRPRKKKMGEDDEEYVDSVQPKSLDENGVTKVMA
ALMQCKEKWIAVKLLRRIERCDDERVRNRVVKMHGYQILNSQLSMWKEDFTVVFQILDIL
DKFPRLTRNKIIDSKIESTIQPLTTCGDERVEQKAATLLQSWATLEVGYRIPRMKRDPNA
VASVSQFGRREQANDEAKRSQSRSRSRSRSLDAPRGPANPHRKGNGQRNNQHRGPRQFRR
QFEPLPPGWFVAEAQGRVYYYNERGDVTWTKPVFSTPESDTPSSHAKNRALQGIIDGILN
AKESAPKEKTATPVTPQAPKQPTNNRSENEEKWRNYSEEKQKKLYENTLFPHIKYVVDKF
KHKLPKEDLKRYAKDVAKKLVNSDFKNNRVEDPTKISEKQQKKVKAFCKEFFDKAVAKHR
AHEQKKAEKQAKGPGSKTEPRTTDQSPIDDADVKMSDDEDRAEEDHTSLGSHSGQKRKRE
EDADGDDRHLDEVTSPSKRQRSTTPIPPPPPPPPPPPPGDEPFAQNDKGEYDLQAEGQSL
SVQNGSVPPPPPPPLSAEHSDNDDSSATPAENNHLNNQKFFPTHSPGTEYETELGDLKST
QIGIEGKV
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atgccctctcatgacaacgcggactctccctcagcgtctgtaacgaatgctgtgaccgca
atgaagctggagcagaacgacggagccgccgagactcccgttctcaacggtggagatgcc
attgcgaagcaagaatcctacgggctatctagccctcccaccgccaccagagatcactcc
gaactgagtggcatgtcttcatccgctgttaagtcgcgagcttcatctcagtccccagtt
aaaattgaaaatggagatacgcctgaaatggaggagaaggttggaggcgacatcaccgtg
aagatggaacctggtcaacctcccaagttgactcgcaccacctctcaaaaggtcgctgcg
cgtccccctcagctgtttctgcatctgccggatggcacagcggaggcccagtcgaccttt
gaggtgatggagacgtgtacttatgctaacaaatacatgggctacacggagcatgcgatg
gaatgcgattgtgccgaggaatgggatcagtccgccggcaaaaacctggcttgcggagaa
gattctgactgcattaatcgcgcaaccaaaatcgagtgtgttggcgattgcagctgtggt
gctaattgccaaaatcaacggtttcagcgaagagagtatgcaaatgtcgcggtcatcaag
acagagaagaaaggtttcggtctccgtgccgagaccgatctgcaaccgcaccagtttatc
ttcgagtacgtcggtgaagttatcaacgaggggcattttaggcgtcgcatgaggcaatac
gatgaagaggggatcaaacacttctatttcatgtccctcagtaagggagaatttgttgat
gcgaccaagaagggcaacctgggccgtttctgtaaccattcgtgcaatcccaactgctat
gtcgacaagtgggtcgtgggcgagaagttgcgcatgggcatcttcgccgaacgggccatc
cgcgctggtgaggaacttgtgttcaactacaacgttgatcgttatggagccgatcctcaa
ccgtgctattgcggcgaaccaaattgcacaggcttcatcggagggaaaacccagaccgag
cgtgcaaccaagctgtccaatgcgactatcgaagctctgggtatcgaggatgctgacagc
tgggatacggcggttgcgaagcggccacgcaagaagaagatgggcgaggacgacgaggag
tatgttgacagcgtgcaacccaagtctctggatgaaaatggcgtcaccaaagtcatggcg
gctcttatgcagtgcaaggagaagtggattgcggttaagttgctgcggcgtattgaacgc
tgcgatgacgagcgcgtccgcaatcgggtcgtgaagatgcacggctaccagatcctcaat
tcccaactcagcatgtggaaggaagactttacagtggtgttccagatcctcgacatcctg
gacaaattcccccgtcttacccgaaacaagatcatcgattcgaagatcgagtccacgata
cagcctctaacgacgtgtggggatgaacgtgtcgaacagaaagcagctacactactgcag
agctgggcgactctggaagtcggttaccgtattccgcgcatgaagcgagatcctaatgcg
gtggcctcggtcagtcagtttgggcgaagagaacaggccaacgatgaagccaagcggtcc
caatctcggtcgcgctcacggtcccgatcattggatgcgcctcgcgggccagcaaatcct
catcgcaagggcaatggccagaggaataatcagcatcgtggcccgcgccaattccgccgc
cagtttgagccgctgcctccgggatggttcgtggccgaagcccagggtagggtatactac
tacaacgagcggggagatgtcacctggaccaagcccgtcttctccacaccggagtctgac
acgcccagcagccacgcgaagaatcgggcccttcaaggtatcatcgatggtatcttgaat
gctaaggaaagcgcgccgaaggagaagacggccacgccggtcactccacaggcgcccaaa
caacctaccaacaatcgcagtgaaaatgaggagaagtggaggaactatagtgaagagaaa
cagaagaaactctacgagaatacgttgtttcctcatatcaaatacgtggtggacaagttc
aagcacaagcttccaaaagaagacttgaagcgctacgccaaagatgtcgccaaaaagctc
gtcaattcggacttcaagaacaaccgagtggaagatccgacgaagatcagcgaaaagcag
cagaagaaagtaaaggcgttctgcaaagagttcttcgacaaggcggttgcgaagcatcgc
gctcacgagcaaaagaaggccgagaaacaggcaaagggaccgggctccaaaacagagcca
aggactacagaccagagccccatcgatgacgcagatgtgaagatgtccgacgacgaagac
cgggctgaggaggaccacacctccctaggctctcacagcggccagaagcgcaagagggag
gaggatgctgatggtgatgatcgacaccttgacgaggtgacttcgccttcgaaaagacag
cgatcaacgacaccgatacctccccctcccccgccaccgccaccccctcctccaggtgat
gaaccttttgcgcagaacgacaagggggagtatgaccttcaggctgagggccaatctcta
tcagttcagaacggctcggttccccctccgccaccgccgccgctatcagcagagcatagc
gacaacgacgactcatccgcgactcccgcagagaacaaccacctaaataatcagaaattc
ttcccgacgcactccccggggaccgagtacgagaccgagcttggagacctcaagtcgact
cagatcggcatcgagggcaaagtatag

DBGET integrated database retrieval system