KEGG   Aspergillus clavatus: ACLA_009470Help
Entry
ACLA_009470       CDS       T01148                                 

Definition
histone acetyltransferase, putative
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ACLA_009470
Transfer RNA biogenesis [BR:act03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    ACLA_009470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 576 aa AA seqDB search
MATLTMTMPPPSKSKNSNEKLPPENERFMRACSDIANALIQEFEAQRDTTKPKKDINLNK
LRGQIAKKHRLATQPPLTAIIAAVPEHYKKYILPKLIAKPIRTSSGIAVVAVMSKPHRCP
HIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQIKSLGH
SVDKVEYIVMGGTFMSLPPDYRESFIAQLHNALSGYQTDSVDEAVQAGEMSNIKCVGITI
ETRPDYCLDTHLSDMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFKLAKDAGFK
VVSHMMPDLPNVGMERDLFQFQEYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYKNY
TPNALVDLVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRD
VRTREVGINEVKNKIRPSQVELIRRDYTANGGWETFLAYEDPKQDILIGLLRLRKCSPTH
TFRPEFTGQQTSIVRELHVYGSAVPVHGRDPRKFQHRGFGTLLMEEAERIAREEHGSQKI
SVISGVGVRSYYARLGYTLDGPYMSKMLHPIEDEEF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccctcacaatgaccatgccgccaccatcaaaatccaagaacagcaatgagaag
cttcctccagaaaatgaacgatttatgcgagcctgttcggatattgccaatgcgcttatc
caggaatttgaagcgcagagggatacgaccaaacccaagaaggatatcaacctcaacaag
ctgcgcggtcaaatcgcaaagaagcatcgtctggccactcaaccacctttgacagctatc
atcgctgcggtgccggaacattacaagaaatatatcctccctaagctaattgcgaagccg
atccggacgtcttcgggcatcgctgtcgttgccgtcatgagcaaaccccaccgttgtccc
catatcgcttacacgggtaacatctgtgtctactgtcccggtggccctgattcggatttc
gaatactcgactcaatcatacactggttacgagccgacatcgatgcgtgcgattcgagcg
cggtatgacccatttgagcaagcaagaggtcgagttgatcagattaaatctttgggccat
agtgtggacaaggtggaatacatcgtcatgggtggaactttcatgtcccttccgccggat
tatcgcgagtcgttcattgcccagcttcacaatgcgctgagtggataccagacggacagt
gtagacgaggctgtccaggcaggcgaaatgagcaatatcaagtgtgttggaattacgatt
gagactcgaccggattattgcttggatacacatctcagcgacatgcttcggtatggatgc
acacgattggagattggagtgcaaagtctgtatgaggatgttgcgagggacacaaaccga
ggccacactgttgctgcggttgcggagactttcaagctcgccaaagatgccggttttaaa
gtggtcagccatatgatgcctgatctacccaatgtcggcatggagcgagatctctttcaa
ttccaggaatattttgagaacccagccttccgtacggacggtctgaagatttaccctacg
ctggttattcgtggtaccggtctctacgaactttggagaactggccggtacaagaactat
acccccaatgcgctggtggatctcgtcgcgcgtattcttgcactggtaccgccatggact
cgtatttatcgtgtgcagcgagatatccccatgcccctggtcacctcaggcgtggaaaat
ggcaaccttcgcgagctggccctggcacgaatgaaagacttcggcactacctgccgcgat
gtacgtacccgcgaggtcggtatcaacgaagtaaagaacaagatccgcccttcacaggtg
gaactcattcgtcgcgactacaccgccaatggtggctgggagacgttcctcgcctacgag
gatcccaagcaggacattctcatcggcttactgcgactgcgaaagtgcagcccgacacat
accttccgtcccgagttcactggtcagcagacgagtatcgtgcgtgagctgcacgtatat
ggctcggccgtgccggttcacggtcgggacccgcgcaagttccagcaccgtggattcgga
accttgttgatggaggaggcggaacggattgcgcgagaagagcatggcagccagaagatc
agcgtcatctctggcgttggtgtccgcagctactatgcgcgtcttggatacaccttggat
ggtccatacatgtccaagatgcttcatccgattgaggatgaggaattttga

DBGET integrated database retrieval system