KEGG   Aspergillus clavatus: ACLA_010190Help
Entry
ACLA_010190       CDS       T01148                                 

Definition
O-methyltransferase, putative
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
act  Aspergillus clavatus
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    ACLA_010190
Enzymes [BR:act01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     ACLA_010190
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ACLA_010190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 280 aa AA seqDB search
MADHVAPHPRPGDRSRDDGKELRLLHFIYGQPDLDEIRGNPQRVLDLIHKFEETTRLSMN
VGAGKGKVMTDLIAQVKPQTMIELGGYVGYSAILFGDAVRRAGGKRYFSLELNPEFAAIA
NMLIELAGLRDFVRIIIGRSDRSLHKLFTSGEVTQIELMFLDHYKPAYTTDLMLCEQLGK
IIPGVSVLAADNVLRPGNPPYLEYVRSTVEQKREAAKKGPVTSYNKEGIPQRLVESFLGD
EDRPSFEMLGNPNLVYESTLHQPEGLQDAIEVTRCVRIRE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcacgttgctcctcacccccgtcctggagatcgctcgcgcgacgacggaaag
gagctgaggctcctccacttcatctacggccaaccagatctcgatgagatccggggtaac
ccccaacgggtcctcgatctcatccacaaattcgaagagacaacccgcctctccatgaac
gtgggagccggaaagggcaaggtcatgaccgacctcatcgcccaagtcaagccgcagacc
atgatcgaactgggcggctacgttggctactccgcgatcctcttcggcgatgccgtgcgc
cgcgccggcggcaagcggtattttagcctcgagctgaaccccgagttcgccgcgatcgcc
aacatgctgatcgagctggcggggctgcgcgacttcgtgcgcatcatcatcggccgaagc
gaccggtccttgcacaagctgttcaccagcggggaggtcacgcagatcgagcttatgttc
ctcgaccactacaagcccgcctacacgacggacctgatgctgtgcgagcaactcggcaag
atcatccccggggtctcggtcctggcggcggataatgtcttgcggccgggtaacccgccg
tatctggagtatgtgcgcagcacggtggagcagaagcgtgaagccgcgaagaagggcccg
gttacgagctacaacaaagagggcattccgcagcggttggtcgaatccttcctgggggat
gaggataggccgagttttgagatgctcgggaacccgaatctagtgtacgagagtaccctg
caccaacctgagggtctgcaggatgctattgaggtgacccgctgtgttaggattagagag
tag

DBGET integrated database retrieval system