KEGG   Aspergillus clavatus: ACLA_013220Help
Entry
ACLA_013220       CDS       T01148                                 

Definition
(RefSeq) cytochrome b5 reductase, putative
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
act  Aspergillus clavatus
Pathway
act00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ACLA_013220
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     ACLA_013220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 Cyt-b5 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 4706404
NCBI-ProteinID: XP_001274313
UniProt: A1CAW9
AA seq 472 aa AA seqDB search
MPEFTVEDVALHKSRDDLWVIIHGKVYDLTQYLRDHPGGADVLIDVAGTDATAAYEDVGH
SEDADEIMQTYLIGTVKDAQQFVRKAAVRVIQAVPPPVVATAAKSSSRTRAVVTTGSAAG
LLSLLYCLRPRNGSLQPQNTIREAFARLPRGTHLLPAAITNLRLPHGGFVNGFAAAALIS
ATIGTIAAVQLSKLTQIDSGFAKYPPHMKSRRLPKPDPHNIPGFLVPKDYKTLPLVQKDV
LAPNVYRFVFQLPNATDIIGLPIGQHVAIKAIVNGQTVSRSYTPTSNNLDRGRLELVIKC
YPDGLLTGQYLANLQVGEEVLFRGPKGAMKYKPNMCKRIGMIAGGTGITPMYQLIRAICE
GDTDTTEISLVYANRGEEDILLRVELEAFARKYPKQFRVYYMLDNPPKGWKYGKGYVTPQ
IMEAYLPKSAADTKIMLCGPPGMVNAAKKGLGGLGFEMPGAVAKVGDRIFCF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttcaccgttgaagacgtggcactgcataagtcgcgtgatgacctgtgggtt
atcatccacggaaaggtctacgacctcacccaatacctccgagaccatcccggcggcgct
gatgttctgatcgacgttgctggaaccgatgccactgccgcatacgaagatgtcggacac
tccgaagatgcggacgaaatcatgcagacgtatctcatcggcacagtcaaggatgcacag
cagttcgtgcgcaaggccgccgtgcgcgtcatccaggccgttcctccaccagttgttgca
acagcagcaaagtcgagttctaggacgcgcgcggtggtcaccactgggtcagccgccggt
ctcttgagcctgctatattgcctgcgtccccgtaacggctcgttgcagccccaaaacaca
atccgcgaggccttcgctcgcctaccccgaggcacgcatctcctccccgccgccatcacc
aacctccgtctcccccacggtggcttcgtcaacggcttcgcagccgcggcgctcatctcc
gccaccatcggcaccatcgccgccgtgcagctctccaagctcacgcagatcgactccggc
tttgccaaataccctccgcacatgaaatcgcgccgcctgcccaagcccgatccccacaac
atccccggtttcctcgtccccaaggactacaagaccctccccctggtccaaaaggacgtc
ctcgccccgaacgtctaccgcttcgtgttccagctccccaacgccaccgacatcatcggc
ctccccatcggccagcacgtcgcaatcaaggccatcgtgaacggccaaaccgtctcccgc
tcctacaccccgacctccaacaacctcgaccgtggccgcctcgagctcgtcatcaaatgc
tacccagacggcctattgacgggccagtacctggccaacctgcaagtcggggaggaagtc
ctcttccgcgggcccaagggcgccatgaagtacaagcccaacatgtgcaaacgcatcggc
atgatcgccggcggcacaggcatcacacccatgtaccagctcatccgcgcgatctgcgag
ggcgacaccgacaccacggagatcagcctcgtgtatgcgaaccgcggcgaggaggacatc
ctgctgcgcgtggagctggaagcctttgcgaggaagtatccgaagcagttccgcgtgtat
tatatgctggataacccgccgaaggggtggaagtatgggaagggatatgtcacgccgcag
atcatggaggcgtatctgcccaagtcggcggcggatactaagatcatgctgtgtggtccg
ccggggatggtgaatgcggcgaagaaggggctgggggggttgggctttgagatgcccggg
gcggttgcgaaggtgggagatcggatattctgtttctag

DBGET integrated database retrieval system