KEGG   Aspergillus clavatus: ACLA_013220Help
Entry
ACLA_013220       CDS       T01148                                 

Definition
cytochrome b5 reductase, putative
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
act  Aspergillus clavatus
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:act00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 472 aa AA seqDB search
MPEFTVEDVALHKSRDDLWVIIHGKVYDLTQYLRDHPGGADVLIDVAGTDATAAYEDVGH
SEDADEIMQTYLIGTVKDAQQFVRKAAVRVIQAVPPPVVATAAKSSSRTRAVVTTGSAAG
LLSLLYCLRPRNGSLQPQNTIREAFARLPRGTHLLPAAITNLRLPHGGFVNGFAAAALIS
ATIGTIAAVQLSKLTQIDSGFAKYPPHMKSRRLPKPDPHNIPGFLVPKDYKTLPLVQKDV
LAPNVYRFVFQLPNATDIIGLPIGQHVAIKAIVNGQTVSRSYTPTSNNLDRGRLELVIKC
YPDGLLTGQYLANLQVGEEVLFRGPKGAMKYKPNMCKRIGMIAGGTGITPMYQLIRAICE
GDTDTTEISLVYANRGEEDILLRVELEAFARKYPKQFRVYYMLDNPPKGWKYGKGYVTPQ
IMEAYLPKSAADTKIMLCGPPGMVNAAKKGLGGLGFEMPGAVAKVGDRIFCF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttcaccgttgaagacgtggcactgcataagtcgcgtgatgacctgtgggtt
atcatccacggaaaggtctacgacctcacccaatacctccgagaccatcccggcggcgct
gatgttctgatcgacgttgctggaaccgatgccactgccgcatacgaagatgtcggacac
tccgaagatgcggacgaaatcatgcagacgtatctcatcggcacagtcaaggatgcacag
cagttcgtgcgcaaggccgccgtgcgcgtcatccaggccgttcctccaccagttgttgca
acagcagcaaagtcgagttctaggacgcgcgcggtggtcaccactgggtcagccgccggt
ctcttgagcctgctatattgcctgcgtccccgtaacggctcgttgcagccccaaaacaca
atccgcgaggccttcgctcgcctaccccgaggcacgcatctcctccccgccgccatcacc
aacctccgtctcccccacggtggcttcgtcaacggcttcgcagccgcggcgctcatctcc
gccaccatcggcaccatcgccgccgtgcagctctccaagctcacgcagatcgactccggc
tttgccaaataccctccgcacatgaaatcgcgccgcctgcccaagcccgatccccacaac
atccccggtttcctcgtccccaaggactacaagaccctccccctggtccaaaaggacgtc
ctcgccccgaacgtctaccgcttcgtgttccagctccccaacgccaccgacatcatcggc
ctccccatcggccagcacgtcgcaatcaaggccatcgtgaacggccaaaccgtctcccgc
tcctacaccccgacctccaacaacctcgaccgtggccgcctcgagctcgtcatcaaatgc
tacccagacggcctattgacgggccagtacctggccaacctgcaagtcggggaggaagtc
ctcttccgcgggcccaagggcgccatgaagtacaagcccaacatgtgcaaacgcatcggc
atgatcgccggcggcacaggcatcacacccatgtaccagctcatccgcgcgatctgcgag
ggcgacaccgacaccacggagatcagcctcgtgtatgcgaaccgcggcgaggaggacatc
ctgctgcgcgtggagctggaagcctttgcgaggaagtatccgaagcagttccgcgtgtat
tatatgctggataacccgccgaaggggtggaagtatgggaagggatatgtcacgccgcag
atcatggaggcgtatctgcccaagtcggcggcggatactaagatcatgctgtgtggtccg
ccggggatggtgaatgcggcgaagaaggggctgggggggttgggctttgagatgcccggg
gcggttgcgaaggtgggagatcggatattctgtttctag

DBGET integrated database retrieval system