KEGG   Aspergillus clavatus: ACLA_013550Help
Entry
ACLA_013550       CDS       T01148                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
act  Aspergillus clavatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACLA_013550
Enzymes [BR:act01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ACLA_013550
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACLA_013550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 689 aa AA seqDB search
MATTDVSQPTPTDGTGVVQLDPWLEPFSDALRHRYSLVEKWMKTINEDEGGLDKFSKGYE
KFGFNVNSNGDITYREWAPNAVQASLVGEFNNWDVTAHPMMKDKFGVWEITIPSKDGVPA
IPHDSKIKIAMDLPSGERIYRIPAWIKRVVQDLEVSPVYESVFWNPPQAERYTFKHPRPK
KPESLRIYEAHVGISSPETRVATYKEFTANMLPRIKYLGYNAIQLMAIMEHAYYASFGYQ
VNNFFAASSRYGSPEDLKELIDTAHSMGLTVLLDVVHSHASKNVDDGLNMFDGTDHLYFH
EGGKGRHELWDSRLFNYGHHEVLRFLLSNLRFWMEEYGFDGFRFDGVTSMLYTHHGIGTG
FSGGYHEYFGPSVDDEGVMYLTLANEMLHQLYPNCITVAEDVSGMPALCLSHSLGGVGFD
YRLAMAIPDMYIKLLKEKADSDWDMGNLAFTLTNRRHGEKTIAYAESHDQALVGDKTLMM
WLCDKEMYTHMSVLTELTPVIERGMALHKMIRLVTHGLGGEGYLNFEGNEFGHPEWLDFP
RAGNNNSFWYARRQLNLTEDHLLRYKFLNEFDRGMQTTEEKYGWLHSPQAYVSLKHEVDK
VLVFERAGLLWIFNFHPTESFTDYRVGVDKAGTYRIVLDTDAPEFGGFGRNVKDTRFFTT
YMSWNGRANYLQVYLPTRTALVLALEDTL
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggctacgacggacgtttctcagccaacacccaccgacggcacaggtgtcgtccaattg
gatccctggcttgagcctttcagcgatgctttgcgacacaggtacagtctggtcgagaag
tggatgaagacaatcaatgaggatgagggtggtctggacaagttcagcaagggctacgag
aaattcggattcaacgtcaatagcaatggagatatcacataccgggaatgggcacccaat
gctgtccaggcatccttggtcggtgaattcaacaactgggatgttacggcgcatccgatg
atgaaagacaaattcggcgtctgggagatcacgattccctccaaggatggcgtgccagcg
attccccatgacagcaagattaagatcgcgatggatctccccagcggcgagcgaatttac
cggataccagcctggatcaagcgggtggtccaggacctcgaggtttcccccgtatacgag
tccgtcttctggaaccctcctcaggctgagcgatacacattcaagcacccccgccccaag
aagcccgagagtcttcgtatctacgaggcccatgtgggcatttcgtctcctgagaccagg
gtcgcaacgtacaaggaattcactgcgaacatgctccctcggatcaagtacttgggctac
aatgcgatccaacttatggccatcatggaacatgcctactacgccagtttcggctaccaa
gtgaacaacttcttcgcagcaagcagtcgctacggttcacctgaggacctgaaagagctc
attgacactgcacatagcatgggtctgacagtgcttctcgatgtcgtacacagccatgcg
tcgaagaacgtcgacgatggcctgaacatgtttgatggaacagaccatctctacttccat
gaaggtggaaagggccgccatgagctgtgggacagtcggctgttcaactatgggcaccat
gaggttctgcgcttccttttgagcaacctgcgtttctggatggaagaatacggatttgat
ggcttccgtttcgatggagtcacgagtatgctttatacgcaccatggaattgggaccgga
ttctccggtggataccacgagtacttcggtccttcggttgatgacgagggcgtgatgtac
ctgactcttgccaatgagatgctccatcaactctatcccaactgtatcaccgtggcagag
gatgtatccggaatgccagcactctgcctatcccattctctgggaggcgttggatttgac
taccgtctcgctatggccatcccagacatgtatatcaagcttcttaaagagaaggctgac
agcgactgggacatgggaaatctcgctttcaccctcaccaaccggcgccacggtgagaag
acaatcgcatatgcggaaagtcacgatcaagctctcgtcggcgacaagaccctcatgatg
tggctctgcgacaaggaaatgtacacacacatgtctgtcctcactgagctcacccccgtc
atcgagcgaggcatggccctgcacaagatgatccgactcgtcacccacggcctgggagga
gagggctacctcaacttcgaaggtaacgaattcgggcacccggagtggctcgacttcccc
cgcgccggtaacaacaactccttctggtacgcacgtcgccagctcaatctcaccgaggac
catctcctgcgctacaagttcctcaacgagttcgaccgcggcatgcaaaccaccgaagag
aagtacggctggctgcactcgccccaggcctacgtcagcctcaagcacgaagtcgataag
gtcctcgtcttcgagcgcgccggcctgctctggatcttcaacttccaccccacagagagc
ttcaccgactaccgcgtcggcgtcgacaaggccggcacgtatcgcatcgtcctcgatacc
gacgctccagaattcggcggcttcggccgcaacgtcaaggatacccgcttcttcacaacc
tatatgtcctggaacggccgtgccaattacctgcaggtctatcttccaacccggacggcg
ttggtactcgctctggaagatacgctgtag

DBGET integrated database retrieval system