KEGG   Aspergillus clavatus: ACLA_015130Help
Entry
ACLA_015130       CDS       T01148                                 

Definition
histone methylation protein Dot1, putative
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
act  Aspergillus clavatus
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:act00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 504 aa AA seqDB search
MGFFDHLQKGGAFSLQAQKPQIRKVVQTRPASLSRSSSHTAVRPSSQISPPEKTKRARDS
TSRSTSGDSDRRPSKRLSTPLRTKKRPTPEQRLSSDDDDASDTDNSFELRKRARTDDSAE
PDLSRRIRSLKAFSEENVKPLPLVHAADIVSKQKAAGNFKRAFSGASGPTEILLQYPSAS
RKERYNLIVPRDNDDFKPTDDIVHVIDIVSENYIPETKADAFNNESTGIRRRLRRALAHS
SEPEFREAVADYNHEIERLRRDGSIARHLDSMHRLSLPLVERILTQIYARTVSPRVDALR
QYENGTDNVYGELLPRFISTIFKETGLKSGQVFVDLGSGVGNVVLQAALEIGCESWGCEM
MANACELAEIQQTEFRARCRLWGIAPGKTHLVRGDFLQEQSIIDVLKRADVILINNQAFT
PQLNNEIINHFLDMKEGCQIVSLKSFVPAGHKIQSRNVYSPINLLKVKQLNYWSNSVSWT
DVGGTYFIATKDSSRLKAFAETME
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggattttttgatcaccttcagaaaggcggcgccttctctctgcaggctcagaagcca
cagattcgcaaagttgttcagacacggcccgcctctctctcaagatcctcatcgcatacc
gcagtccgaccatcatcgcagatttcacctccagagaagaccaagagagcacgagactcg
acgagcaggtccacctcgggggattctgatcgccgtccttctaaacgtctcagtacccct
ttgcgaaccaagaagcgacccacgccagaacaacggctatcgagcgatgacgacgatgcg
agtgacacggataattcctttgagttgcgcaagcgagcaaggacggatgatagcgcagag
cctgacctttcaaggcgcatacgttccctgaaagccttctctgaagagaatgtcaaacca
ctgccattagtccatgctgcagatatcgtatccaagcaaaaagctgctgggaacttcaaa
cgagcgttcagtggagcgagcgggccaacggagatccttctgcagtatcccagtgcttcg
cgaaaagaaagatataatcttattgtaccgcgcgacaacgacgacttcaaacccaccgat
gatattgtccatgttattgacatcgtttccgaaaactatatccctgaaactaaagcagac
gccttcaacaatgaatctacgggcattcgacggaggttgcgccgagcacttgcccattca
tccgaacctgagttccgagaagctgtcgccgattacaaccatgaaattgaacggttgagg
cgtgatggatccatcgcgaggcatctggactcgatgcatcgactgagcctgccgctggtg
gagcgcatattgacccaaatatacgcgcgtacggtatctcctcgggtcgacgctcttcgt
cagtacgagaacggaacggataacgtctacggagaacttttgcctcgatttattagtaca
atcttcaaggagacgggactgaagtcgggacaagtgttcgtcgacttaggatccggagtc
ggaaatgtcgttctgcaagccgcgctggaaatcgggtgtgaaagttggggctgtgagatg
atggccaatgcttgcgagctggcggaaatccagcaaactgaattcagagcacgatgccgg
ctgtgggggattgcgccagggaaaacacaccttgtccgtggtgatttcttgcaagaacaa
agcattatcgatgttttgaaacgcgcagacgttatcttgatcaataatcaagcatttacg
cctcagctcaataacgaaattatcaaccactttttggacatgaaagagggctgtcagatt
gtgtcgctcaaatcttttgttcctgcgggccataagatacagtctcgcaatgtatactct
ccgatcaatcttctgaaggtcaaacaactgaactactggtcgaacagtgtcagctggacc
gatgttggtggcacatatttcattgcaaccaaagacagttccaggcttaaggcttttgct
gagactatggagtaa

DBGET integrated database retrieval system