KEGG   Aspergillus clavatus: ACLA_015710Help
Entry
ACLA_015710       CDS       T01148                                 

Definition
nuclear pore complex subunit Nup192, putative
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
act  Aspergillus clavatus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:act00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ACLA_015710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1668 aa AA seqDB search
MEGRDTLAGLRGLYQDLSALSDSSFVNIERLRIELEAHIEDFRKLLDKPTKNNTSRQTVL
SGKITVDDVEYSINQDFQQGALQLADALNIDELEAAVLFLAAQEEAQMLDRPPLIAAIMR
FHERRHFLLECLRLILQETFEVEREVTQALMQEMVAFVVEIKNGPLRNASLYARKCMKSM
EEIEGWLLLLGEQVQKASIVGQTGDRDVMEAIEYQRNSLQQQHESLGAIICYFFKGPYTS
PEDLRVLLTRLRKLDRIDGLLVHYIPAMISSFVQHGSPERSNSYKEARSLHTAVTSTKDG
QNWKLPTFHAAVVALWLAVYSGWDIDGPSSPVQGVDLDKEAEERTKMFMTVLDDGGLEFL
LAVCASVNNEEWTDPARRELVTLLLKEGASANLELGSCAGFLKTLLMENLEAFVESCIAN
MPDAVRKLKSEEDMQRLDQITALRDGLTSSHHRGLVEARTHLESFLIIMAFAFDGRPDAA
QEFWADPDGNLYGFLQWASKRQTVPRVSAFCELICSISGGEENAAAAQRFLSEEDKFLSA
KFKRSTSMNWSQMFAELQLYASRVNEKPVASQSVLRARKTEPVDMSEPESPVMLTCYLRL
MGHLCRQSASIREWMLHHPSNNIVSTLLTLCSGPVPTHLRATVFTTLAALMTGRSSHNGN
EMWLSLDQWISGGATSASGLGKVPIVSNPLVWHEHQAFQKIGESFDQANAFVVLIYSLVS
PTSDSADFHLSLPFPESLGSSYRMPGIEPYIDFVLGQALSRKVPDLSERQTRLLTYNCLD
FIITCLKSFNESIVTVLSQPAVSAELSLKTSSLVTYIRLHPFARVAEWLFNEDVIKALFA
TAQQDATEVANAASDSVLVQCLVKSLEVMDLILDLQSTYFDIVRPSIKSQAGGSRLNVAN
SSLSAFEDSVLNHLTIIPALSLYCGAGHEQLTVTSMALLEKLSSSRKLNKMSSPELLKWQ
SANKIVEVLSTEVDVDSVSRPLVSQMQPELRELELGSRSSGYIIRENLLALLNSCLGAIT
DRPTIAHLLLGFRSVGTMLDVAPNSLFAEGMSLLHAIIGFLQSYPDALEGNILAWMVHLR
RMAFEVLKHLWSSKISSPFTLLEMRSSRFLLNMFANQPIIGPNTLFDGLSIMEEEFWISE
SASALAEFLLYRSYLYAYATTEIRSAAKLGSQTLQTNILSTLLGNSTTESGEMILNPTVF
DLFDFADLDLSQRFQPPKLVFLDGIGVDLCAKSQADESLVLYNLAEVAELIQIRKEELIS
NGQLRPQDEEQFQAEAESLTLFIRATNQARQIVFNCYFALRSWTELIKTMLACSEIEDGR
KSTFILHSIQLILPKLEAAIEDDLPEALGLAQLAETLISSLEPTSTSTHAVRRSGDIIDE
KLHQLFQICIRGIILATGNVHLRETFYNIGSQYINRIVSADAVNQNSKHHSQHVIKTASP
TLIETTCDDAYAGQEACRVSALLFLNLLACLDQKTDSSLAEAISQSNYLSLFLDAVRALP
IELKNAQASDTPSLLSYYESLLSLLQRLCQTKNGAIHVLKTGLFQAVRDSRLFTADPDLG
IDIDNPDALRKYYDLLGSVLRVIISAVFSRGLHNEQMLEQTRAFLAENRQSMVGIFKRFA
NIGGAGAAEHHEALSELAKCYMTLVTTTDFLEFEDEEVKELSRPTLFS
NT seq 5007 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcagggatacactggcaggccttcgtggcctttaccaggatctttctgcgctt
tcagactcgtcgtttgtaaacattgaacgacttcgtatcgagttggaggctcatattgaa
gatttcaggaaactcctggacaaacccacgaagaacaacacaagtcggcagaccgttctc
tcagggaagattacagtcgatgatgtcgaatattcaattaatcaggacttccaacaagga
gcgctacagctcgcggatgctctcaacattgacgaactggaagcggcagtcttgttcctc
gctgcccaagaggaagcccagatgctggataggcctcctttgattgcggcgatcatgcgc
ttccatgagcgtcggcactttcttctcgaatgcttgcgtctcattctacaagaaacgttt
gaggttgaaagagaagtgacacaagctcttatgcaagaaatggtggcttttgttgttgag
atcaaaaacgggccattgaggaacgcatcactctatgcgcggaagtgcatgaaatcgatg
gaggaaatcgaggggtggctgctactccttggggagcaggtgcagaaagcttcgattgtt
ggtcaaacaggggatcgggacgtgatggaggctattgaatatcaacgcaacagcctgcag
caacaacatgagtcgctgggggcaataatatgctacttcttcaagggcccttacaccagc
ccggaggacctccgagtgcttctcacacgactgaggaagctcgaccgaatcgatggcctt
ctagtccactacattcctgctatgatctcttcattcgttcagcatggctctcccgagcgg
tccaattcttacaaagaagcgagaagtctacacacagctgttacttccaccaaggacggt
caaaactggaagttaccgacatttcatgctgctgtagttgcgctttggctagcagtgtac
agcggctgggatattgatgggccttcatcgcctgtgcaaggagttgacctcgataaagag
gcagaagaacgcacgaagatgttcatgactgtcttagacgatggaggattggaattcctg
cttgctgtttgcgccagcgtaaacaatgaagaatggaccgatcctgcccgtcgcgaactc
gtaactctcctgttgaaggagggtgcatcggcaaatctggagctaggatcatgtgctgga
ttccttaagactctattgatggagaatcttgaagccttcgttgaatcatgcatcgctaat
atgccagatgccgttcgcaagttgaaatctgaagaggatatgcagcgcttagatcaaata
actgccctcagggatggcctgacatccagccatcatcgcggcctggtggaagctcggacg
catcttgagtcgtttctcataatcatggcatttgcctttgatggtcgaccggacgcggct
caggaattctgggctgatccggatggcaatctgtatggtttccttcaatgggcgtctaag
agacagacggtaccaagagtcagtgcattctgcgagttgatatgttctatttcagggggc
gaagaaaatgccgccgcagcgcaacgtttcctgtctgaagaagacaagttcttgtcggcc
aagttcaagcggtctacctctatgaattggtcccagatgtttgctgagcttcaactatac
gcaagtagggtcaatgagaagcccgtcgcgtctcagtctgttctgcgtgctcgaaagacg
gagccagtcgacatgagcgaaccggaaagtcctgtcatgctgacatgctatctccgattg
atgggtcatctgtgtagacaaagcgcatccatcagggaatggatgcttcatcacccgtca
aataatattgtcagcaccttgttaacattatgcagcggcccagtacccactcatctaagg
gccactgtgttcacaaccctcgcagctttaatgacgggaagatcctcccacaatggcaat
gagatgtggctttcacttgatcagtggatttctggaggtgctacgagtgcttctggtctc
ggcaaagtgcccatagtctcgaatccactggtttggcacgagcatcaggccttccagaag
ataggcgaaagctttgaccaggccaatgcctttgtcgtcttaatctactcgcttgtttct
cccacatcggattcggctgacttccatctttccttgcctttccctgaatctttggggtca
tcttatcgtatgcctggtatcgagccatacattgacttcgttctgggccaggctttgtcc
agaaaggttccggatttaagcgaacgccagactcgtcttttaacttacaactgcttggat
tttatcatcacctgcctcaagtcgttcaatgagagcatagtcactgttctcagccaaccc
gctgtcagcgctgagctcagcttgaaaacgtcttcgctggttacttatatccgtcttcat
ccatttgcccgtgtagctgaatggcttttcaacgaagatgtgatcaaagccctctttgcg
actgctcaacaagacgcaaccgaagttgctaatgccgcatctgattcggtccttgttcaa
tgcttggtcaaaagtcttgaggtcatggatctcatcttggacctccagtcgacctacttt
gatattgttcggccgtcgatcaagtctcaggcgggtggaagcaggctcaacgttgcgaat
tcgtcactctccgccttcgaggacagtgtcctgaatcatttgacgataatcccagccctg
agcctttattgcggggctggtcatgagcagctgacagtgacatcaatggcgcttctggag
aaattgtcaagctccaggaagctgaacaagatgtcatcaccagagctgttgaaatggcaa
tctgcaaacaaaatcgtggaagtgttgagcacagaagtggacgtggacagtgtttcgcgg
ccactagtatcgcaaatgcagcctgaattgagggagttagaactcggctcgcgatcctct
gggtatatcatcagagagaatctgctggcacttctcaatagttgtctgggcgcgatcaca
gaccgcccaaccattgctcatcttctccttgggttcaggagtgttggcaccatgcttgac
gttgccccgaatagtctgttcgctgagggaatgtcactgttgcatgctatcatcggtttc
ctgcagagctatcccgatgcactagaaggcaatattcttgcatggatggttcatttgaga
cgtatggctttcgaagtcctcaagcatttatggtcatccaaaatctcatcccctttcaca
cttctggagatgcgctcgagccgttttctcctcaacatgtttgccaatcaacctataatt
ggaccaaacactttgtttgacggcttgtctatcatggaagaagagttctggatttctgaa
tcagcttctgctctggcagaattcttgctctaccggagttacttgtatgcttatgccacc
accgagattcgttccgctgcgaaattgggctcgcaaacacttcagacaaacatcctctca
acattgcttggaaactcgacgacggagtcgggagaaatgatacttaatcccactgtgttc
gatctctttgactttgctgaccttgatctcagccaacgattccagccacccaaattagtc
ttccttgacggcatcggcgtcgacttgtgtgccaaatcgcaagcagacgagtctcttgtc
ctctataatctcgcagaagttgcagaattgatccagatcagaaaggaagagttaatatca
aatgggcaattgcggcctcaggatgaagaacaatttcaggctgaggctgagagtttgaca
ttgttcattcgcgcaacgaatcaagcaaggcaaatcgttttcaactgttacttcgctctt
cggtcatggacagagctcattaagacaatgcttgcttgttcagaaatcgaggatggccgg
aaatcaactttcatcctccattcaattcagctgattcttcctaagcttgaagctgccatt
gaggacgaccttccggaggcgcttgggctcgcacaactggctgagactctcatcagtagc
ttagagccgacaagcacaagtacacacgcggtccggcgaagtggagacattatcgatgag
aaacttcatcagctgtttcaaatatgcatacgagggattattcttgcaaccggcaatgtt
catctgagggaaacattttataatattgggtctcagtatatcaaccgtatcgtttctgcc
gatgcagtcaaccaaaactcgaaacaccacagccagcatgtcatcaaaacagctagccct
accctgattgagaccacctgcgatgacgcgtatgctggtcaagaagcatgccgggtatca
gctcttttgtttctcaatctgctcgcgtgtctcgaccagaaaacagattcttctttggcg
gaggcgatatcccaatcaaattacctaagtctgttcttggacgctgtcagagcgctaccc
atagaattgaaaaatgctcaagcaagcgatacgccatccttattgtcatattacgagtcc
ttgctatccttgttgcagcgactctgccaaacaaagaatggagcaattcatgtcctaaaa
actggcctcttccaggctgtccgtgattcaaggcttttcaccgctgaccccgacctgggt
atcgatatcgataacccagatgctcttcgcaagtattatgatctccttggctcagtactc
cgggttattatctcggctgtattttctcgggggcttcacaatgagcaaatgttagagcaa
acacgagctttccttgctgagaacagacagagcatggtcggtatctttaagcgcttcgcc
aatattgggggagcaggtgctgctgaacatcacgaagcgctaagtgaattggccaaatgc
tatatgacacttgtcactacaacagatttcctggaatttgaggatgaggaagtgaaggaa
ttgtcccgtcctacattattttcctag

DBGET integrated database retrieval system