KEGG   Aspergillus clavatus: ACLA_016430Help
Entry
ACLA_016430       CDS       T01148                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
act  Aspergillus clavatus
Pathway
act00010  Glycolysis / Gluconeogenesis
act00051  Fructose and mannose metabolism
act00562  Inositol phosphate metabolism
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
act01130  Biosynthesis of antibiotics
act01200  Carbon metabolism
act01230  Biosynthesis of amino acids
Module
act_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
act_M00002  Glycolysis, core module involving three-carbon compounds
act_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACLA_016430
   00051 Fructose and mannose metabolism
    ACLA_016430
   00562 Inositol phosphate metabolism
    ACLA_016430
Enzymes [BR:act01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ACLA_016430
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ACLA_016430
  Exosomal proteins of bladder cancer cells
   ACLA_016430
  Exosomal proteins of melanoma cells
   ACLA_016430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-GeneID: 4706620
NCBI-ProteinID: XP_001274623
UniProt: A1CBS9
AA seq 249 aa AA seqDB search
MSRQFFVGGNFKMNGVSDTITSIITNLNQAKLDPSVEVVISPTSLYLLLARQTADSKIGI
AAQNVFDKPNGAFTGEISVEQLKDAKIDWTIIGHSERRVILKEADDFIARKTKAAIEGGL
SVILCIGETLEEREASKTIDVVTRQLNAVAKELSKDQWQKVVIAYEPVWAIGTGKVATTE
QAQEVHAAIRKWLTDAVSPETAETVRIIYGGSVSEKNCRDLAQQPDVDGFLVGGASLKPA
FVDIINARL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccaattcttcgtcggtggtaacttcaagatgaacggtgtcagtgacaccatc
acctccatcatcaccaacctcaaccaggccaagctcgacccctccgtcgaagtcgtcatc
tcccccacctccctctacctcctcctcgctcgccagactgccgactccaagattggtatt
gccgcccagaacgtattcgacaagcccaacggtgctttcaccggtgagatcagtgtcgag
cagctcaaggatgccaagatcgactggaccatcatcggacacagcgagcgccgtgtgatc
ctcaaggaggctgatgattttattgctcgtaagaccaaggctgccattgagggtggtctg
agcgtcatcctgtgcatcggtgagactcttgaggagcgtgaggctagcaagaccatcgat
gtcgtcaccaggcagctcaacgctgtcgccaaggagctgtccaaggaccagtggcagaag
gtcgtcattgcctacgagcccgtctgggccatcggaaccggcaaggtcgctaccaccgag
caggcccaggaggtccacgctgccatccgcaagtggctcaccgacgccgtctcccccgag
accgccgagaccgtccgtatcatctacggtggctccgtcagcgagaagaactgccgtgat
ctggcccagcagcccgatgtcgatggtttcctggttggcggtgccagcttgaagcctgcc
ttcgtcgacatcatcaacgcccgtctgtaa

DBGET integrated database retrieval system