KEGG   Aspergillus clavatus: ACLA_016430Help
Entry
ACLA_016430       CDS       T01148                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
act  Aspergillus clavatus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:act01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:act01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:act00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:act00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:act00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 249 aa AA seqDB search
MSRQFFVGGNFKMNGVSDTITSIITNLNQAKLDPSVEVVISPTSLYLLLARQTADSKIGI
AAQNVFDKPNGAFTGEISVEQLKDAKIDWTIIGHSERRVILKEADDFIARKTKAAIEGGL
SVILCIGETLEEREASKTIDVVTRQLNAVAKELSKDQWQKVVIAYEPVWAIGTGKVATTE
QAQEVHAAIRKWLTDAVSPETAETVRIIYGGSVSEKNCRDLAQQPDVDGFLVGGASLKPA
FVDIINARL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccaattcttcgtcggtggtaacttcaagatgaacggtgtcagtgacaccatc
acctccatcatcaccaacctcaaccaggccaagctcgacccctccgtcgaagtcgtcatc
tcccccacctccctctacctcctcctcgctcgccagactgccgactccaagattggtatt
gccgcccagaacgtattcgacaagcccaacggtgctttcaccggtgagatcagtgtcgag
cagctcaaggatgccaagatcgactggaccatcatcggacacagcgagcgccgtgtgatc
ctcaaggaggctgatgattttattgctcgtaagaccaaggctgccattgagggtggtctg
agcgtcatcctgtgcatcggtgagactcttgaggagcgtgaggctagcaagaccatcgat
gtcgtcaccaggcagctcaacgctgtcgccaaggagctgtccaaggaccagtggcagaag
gtcgtcattgcctacgagcccgtctgggccatcggaaccggcaaggtcgctaccaccgag
caggcccaggaggtccacgctgccatccgcaagtggctcaccgacgccgtctcccccgag
accgccgagaccgtccgtatcatctacggtggctccgtcagcgagaagaactgccgtgat
ctggcccagcagcccgatgtcgatggtttcctggttggcggtgccagcttgaagcctgcc
ttcgtcgacatcatcaacgcccgtctgtaa

DBGET integrated database retrieval system