KEGG   Aspergillus clavatus: ACLA_018700Help
Entry
ACLA_018700       CDS       T01148                                 

Definition
protein kinase (Lkh1), putative
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     ACLA_018700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 667 aa AA seqDB search
MSTPSTATATHPSHHQQHYAFPHHHAYQPTASFPATTTAGTTRLATVPYPYAANPSTAPL
PYTQSPKMAQPTPTLAAMAPAQNGVGTSTPGSDQSRRRKKPDWGEFYKNGLPKEVIVIDD
TPPPEQAQVKARNAANANAVAANGAVAQPAGKKRRTGVETAYDLGYYDRPSFSTIPQHYG
EESSAASISTDRTTSLHTTAPTSLGSTGSAGASNGAYYEDANVGQKRKRVTTRKSARDEQ
KRRELETAGDAFLSYIPPPKPPIKAKDVPVPVIRDYGNRHEKFDDNDGHYIVNPETPLTD
RYSIIRLLGQGTFGKVVEAYDKQRKTRCAVKIIRSIQKYRDASRIELRVLSTLASNDKSN
RNKCIHLRDCFDFRNHICIVTDLLGQSVFDFLKGNGFVPFPSSQIQNFARQLFTSVAFLH
DLNLIHTDLKPENILLVNNAYQTFTYNRTIPSSSHAISRNARQRRVLLDSEIRLIDFGSA
TFDDEYHSSVVSTRHYRAPEIILNLGWSFPCDIWSIGCILVEFFTGDALFQTHDNLEHLA
MMEAVIGQRIDTKMVKQTTQGGRNGSQNQAAKYFNRNKLDYPNEETTRASRKYVRAMKQL
TDFIPTSTTFHRLFLDLLQRIFVYDPKNRITAKDALKHPWFKESLIDDGTEALRIGQQLQ
RNGGQRS
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtctactccctcaacggcgacagccacgcatccttcgcatcaccaacaacactacgca
ttccctcatcatcacgcctaccagccaaccgcctcctttcctgccacaaccactgcaggg
accactcgcctagccaccgtaccttacccgtacgccgccaacccatcgaccgcccccctt
ccgtatacccaatctccaaaaatggcgcagccgactcctaccctggcggccatggctccc
gctcagaacggcgtgggcaccagcacgcctggctcggatcaaagcaggagaaggaagaag
ccggattggggcgagttttacaaaaatggtcttccgaaggaggtgattgtcatcgatgac
actcctcccccggagcaggctcaggtcaaggcccgaaatgctgccaacgcaaatgccgtg
gcggcgaatggtgcagtggctcaacccgccggcaagaagcggcgcactggggtcgaaacc
gcctacgatctgggctactacgatcgtccatccttctcgaccatccctcagcactacgga
gaggaatcatccgctgcctccatctcgaccgaccggacgacttccttacataccacggct
cctacatccctggggtcaacaggcagtgctggtgcaagcaatggggcatactacgaagat
gccaacgtgggtcagaagcggaagcgagtaacaactcgcaagtctgcgcgcgatgagcag
aaacggcgggagctggaaacggcgggtgatgcctttctgagttatattcccccgcccaag
cctccgatcaaggccaaggatgtccccgtaccggtcatccgtgattatggaaaccgccat
gagaaatttgacgacaatgatggtcattatattgtgaacccagagactcccttaacggat
cgatactcgatcatcaggctactcggacaaggtacctttggcaaagtggttgaggcgtat
gacaagcagcgcaaaactcgttgcgcagtgaagatcattcgatcaatacaaaagtaccgg
gacgcgtcgaggatcgaacttcgggttctgtccactttggcatcaaatgacaagtccaac
cggaacaagtgcattcatctgcgcgattgttttgatttccggaatcacatctgcatcgtc
acggatcttttgggccaaagcgtctttgattttctcaagggcaacggtttcgttccgttc
ccgagcagtcaaattcagaatttcgcccgtcaactctttaccagtgtggctttcctccat
gacctcaatttgatccataccgatctgaagcctgagaacatcctcctggtcaacaacgcc
taccagacctttacctataatcgcacaatcccctcctcttcgcatgccatttcgcgtaat
gctcgtcagcgacgtgtactgttggacagcgagatccgtctcattgatttcggctctgcc
actttcgatgatgagtatcactcctcagtcgtgtccacccggcattatcgggcccccgaa
atcattctgaacctgggctggagcttcccctgtgatatctggagcatcggatgtatcctt
gtggagtttttcaccggagacgctctcttccagacacatgataatctcgaacatcttgcc
atgatggaggcggtcatcggacagcggattgacacgaaaatggtgaagcaaacaacacaa
ggaggacgaaatgggagccagaaccaagcagccaaatactttaatcggaacaaactcgac
taccctaacgaggagacgacacgggcgtcccggaagtacgtgagggccatgaaacagctc
acggattttatcccgaccagcactacgttccatcgcctattcctggatcttctgcagcgc
atctttgtttacgatcccaagaatcgtatcaccgccaaggatgctctgaagcatccgtgg
ttcaaggagtctttgattgatgatggcaccgaggctcttcggatcggacaacaactgcaa
cgcaacggcggtcaacgcagctag

DBGET integrated database retrieval system