KEGG   Aspergillus clavatus: ACLA_019410Help
Entry
ACLA_019410       CDS       T01148                                 

Definition
choline kinase, putative
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
act  Aspergillus clavatus
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACLA_019410
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     ACLA_019410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 748 aa AA seqDB search
MALESDHFLDGLKPISGTGLNIPSFQKILAENGQASPASPAAEGSPAKQHRASFARKATA
RPPLHTTSHTPSVMSEPRTQTEKDHSAKHTGTDPRDSLFHQVYEWLQHEKAKQKTCRSRL
TGTTQGTDSDGDDDYYDGVLQTSTFPGGESPPSLDKLEKILVRYAALRIEGSAPGHSHRG
PTRKRSRIRGLRRGSVSESDYYDVDAAAPSVDALLDNSKTLAYTGGSAEDGGEADDRRSK
DREAWLTFKNEIARLAITLRLKGWRKFPQELAGEIEVVRLSGALTNAVYVVNPPKALPPP
KAEDGSFSLIPQKLPPKLLLRIYGPQVDHLIDRENELQILRRLGRKHIGPRVLGTFNNGR
FEEFFEARPLTPKDLRVPDTMKQIAKRMRELHEGIDLLEEEREGGPVVFKNWDKWVDRCE
QVINWLDEELQSEHNEARAASEPWRRRGFVCGVPWALFRKAVDNYRKWLVSSCGGMKEIK
RQLVFAHNDTQYGNLLRMEPSSESPLLLPENKHKQLVVIDFEYASANTPGFEFANHFSEW
CYNYHDAERPWACNNSLYPTSEQQRVFIASYLTHSPGVRSSASPSITPLMRGNTATITPF
VPLDLDSNTDADLQRHLEVEKSQGDALEAEIQSLMKQTRMWRVINSAQWVAWGIVQAKVP
GMEESAADVAAKGSNGNGHSEDSVIEAAQVEAPEQAAADAEADEFDYLAYAQDRAMFFWA
DLLALRLVREDELPPPMVELIRARKIDY
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggaatctgaccattttctagatggattaaagccaatctccggaactggtctg
aatatcccatcttttcagaagatcctagcggaaaatggacaagcaagcccagcaagtccg
gcggctgaaggaagtcctgccaagcagcaccgtgcttccttcgccaggaaagctactgcc
cggccgccgttgcataccacatcgcacacccccagcgttatgagtgaaccccgaactcag
actgaaaaggatcacagcgcgaagcataccggcaccgatcctcgggacagtctctttcat
caagtgtatgagtggcttcaacacgaaaaggccaagcagaagacctgtagatcgaggttg
acaggcactacccaaggtaccgacagcgatggcgacgacgattattatgacggtgtccta
cagacaagcacatttcctggcggcgaaagcccaccatctctcgacaagcttgaaaagatc
ctagtacggtacgctgcattgcgaattgaaggatctgcacctggtcactcccatcggggc
cccactcggaagcgttctcgtatccgtgggctgcggagaggctctgtgtccgagtctgac
tattacgacgtcgacgcagcggctcccagtgtggacgccctccttgataattccaagacg
ctcgcgtacacgggaggcagcgcggaggatggtggtgaggctgatgatcgacgatcgaaa
gaccgagaagcttggttgactttcaagaacgagattgcccgtcttgccatcacccttcgg
ctgaaaggctggcgcaagttcccccaggagcttgccggagagatcgaagtagttcgcttg
agcggtgcgttgaccaacgccgtgtatgtggtcaatccgccgaaagcccttcctccaccc
aaggctgaagacggatcgttttccctgattccccagaaacttccaccgaagcttctcctg
cgcatttatggtccgcaagtggatcatctgattgaccgggaaaatgaactgcagattctt
cgccgtctgggccgaaagcatattgggcctcgagtactgggaacctttaacaacggccga
ttcgaagaatttttcgaagctcgtccgttgacgccgaaggatctgcgggttcccgacacc
atgaaacagatcgcgaaacgtatgcgtgagctgcacgaaggcattgatctgctcgaagag
gagagagagggaggccccgtagttttcaagaactgggacaaatgggttgatcgctgcgaa
caagtcatcaactggctagacgaggaattgcaatccgagcacaatgaggcaagagcagct
tccgaaccttggcgccgtcgtggctttgtctgtggtgttccatgggcactattcagaaag
gctgttgacaactatcggaaatggcttgtctccagctgtgggggaatgaaggagatcaag
cggcagctggtatttgcccacaacgatacgcaatacggtaatcttctccgaatggagccc
agctccgagtcgccgcttcttctacctgagaacaagcacaagcagctggtagtcatcgat
tttgagtacgcgtcggcgaacacacccggctttgagtttgcaaaccactttagcgaatgg
tgttacaattaccatgacgcggagagaccctgggcctgcaacaacagcctgtatcccact
tccgagcagcaacgagtattcatcgcctcctacctgacacatagtcccggggtacggtcg
tcggcttctccatccattactcctctgatgcgagggaacactgcgaccatcacccctttc
gttcctctggacctcgactcgaacaccgatgcggatttgcagcggcacttggaggttgaa
aaatcccaaggagatgccctcgaggccgagatccagtctttgatgaaacagacccggatg
tggcgtgtgatcaactccgcacagtgggtcgcctggggcattgtacaggccaaggttccc
ggtatggaggagagcgcggcggatgtagctgcgaaggggtccaatggcaatggccatagc
gaggactctgtcatcgaggcagcgcaggttgaggcgccggagcaagctgcagctgacgcc
gaagcggacgagttcgactatcttgcttacgcgcaggaccgggcgatgttcttctgggca
gatctgcttgccctgcgtcttgtgcgggaggacgagctcccgccgccgatggttgagctg
atccgggctcgcaagatcgactactaa

DBGET integrated database retrieval system