KEGG   Aspergillus clavatus: ACLA_020240Help
Entry
ACLA_020240       CDS       T01148                                 

Definition
dsDNA-dependent ATPase (Rad54b), putative
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
act  Aspergillus clavatus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:act03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 976 aa AA seqDB search
MVFKPFKPPSIRKPPHLSSSDTNPEKAPSDRFEPPAKKQRLDTDNDPLSHSQGLTRKPLQ
QVTNPSRTSSDSAVGDELPGVKYYNVLWRKPTTKKNKTWDGDGILSARDGYLYLQDISGK
DMGRAMMPGSRLEAGSMLSIGGKEVEVDSEIPRKEYLAGKSFLGKKEGASPLVTAAELPK
KAFVPSLTNRSAVLGPTLPSEKTQSGKTCVPPLANPASRSSSITGAYKRPLLDGTVVPVM
PASKPVPRHDPNQPGALVMKRPESVPKGKQIVDVVVDPILSKHLRPHQREGVQFLYECVM
GMRSFNGEGAILADDMGLGKTLQTITLLWMLLKQNPIHDSAPVIKKALIVCPVTLINNWR
KEFRKWLGNERIGVFVFDDKRKRLTDFTKGRAYSVMIVGYEKLRTVQEGLARGAGVDIVI
ADEGHRLKTLQNKSGQAIQALNATKRIILSGTPIQNDLKEFFAAVDLVNPGILGTFKAFV
KEFEGPIVRSRQPEATRKEIEKGEARNEELRELTSKFMLRRTADILAKYLPPKSEYVLFC
NPTSTQANIYRNVLASPVFQCAIGNSENALHLITILKKLCNSPSLLSPKNADETPSETIA
ALLSSLPPNLLRHFSPSSSAKIRVLDQLLHNLRTSTSEKIVLVSNYTSTLNLLANLLSSL
SLPFLRLDGSTPAQKRQSLVEDFNRLPADLCFAFLLSAKAGGTGLNLIGASRLVLFDVDW
NPATDIQAMARIHRDGQKRHCRIYRILLKGSLEEKIWQRQVTKIGLADSVMEHKSSVAQF
SRDELRDLFRLDEESRCQTHELLGCDCGGTGRTVQSASSVPPTDAESKDPTSDPNLSSSS
DLSDVEDDFPDTLTLIKASQVNMEEQERRIRAMRGTTRRAIRTTKIDDSDDDDDDEGEDP
VKPKSKMQQSLSQYSHIDPALLASEEDGLGLAAAIDDDDVLLPLLRDEDNRIGFIFKKSG
QAEAKGKRASSPVVLE
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcaagccgtttaaacccccttcgataaggaaaccacctcatctatcctcctca
gacacaaatccagaaaaagcaccctccgatcgcttcgaacctcccgccaagaagcagcgt
ttggacactgacaacgatcctctgagccattcgcaaggcttaacacgcaagcctctgcag
caagtaacaaatccgagtcgaacatccagcgacagcgcggtgggcgatgaattacccggc
gttaagtactacaatgttctatggcggaaacccacgacgaagaagaacaagacctgggat
ggcgatgggatcctgtccgcgcgcgatggatacctctacctccaagatatctcggggaag
gacatgggccgcgcgatgatgcccggttctcgactggaggcgggaagtatgctctcgatt
ggaggcaaggaggttgaggtcgactccgagatcccccggaaagagtatctggccggtaaa
tccttcctggggaagaaggagggtgcttctccactcgtcacggctgcagagctgccgaag
aaggcgttcgtgccatcgcttacgaatcgaagcgcggtgttgggtccgacgttaccgagc
gagaagactcagagtgggaagacctgcgtgccgccgctggcgaacccggcgtcccggtcg
agttctattaccggggcgtacaagcggccgttgctggatggtactgttgttccggtaatg
cctgccagtaagcctgttccgcgccatgaccccaatcaacctggggcactggtgatgaag
cgaccggagtcggtacccaaggggaagcagatcgtggatgttgttgtcgatccgattctg
tccaagcatttgagaccacatcagcgggaaggcgttcagttcctttacgaatgcgtcatg
ggaatgcggtcgttcaatggtgagggagccatacttgcggatgatatgggactaggaaaa
acgttgcaaacaatcacgctgctgtggatgctactcaaacagaatcccattcacgacagc
gctccggtgatcaagaaagcgctaatcgtttgtccggtgactttgatcaataactggaga
aaggagttccgtaaatggctcggaaatgagaggattggcgtgtttgtctttgacgacaag
aggaagcggttgaccgacttcaccaagggcagggcctatagtgtgatgatcgtgggttac
gagaagctgaggaccgttcaagaaggcttagcaaggggtgctggcgtcgacatcgtcatc
gccgacgagggccatagactgaaaacgttacagaataaaagcggccaagccatccaggca
ttgaacgccaccaagcgaatcattctctctggcacgccaatccagaacgatctgaaggag
ttcttcgcggcggtggatctggtcaaccccggcattttgggtaccttcaaggccttcgtc
aaagagttcgaagggccgattgtgagaagtagacaaccagaggctacgagaaaggagatc
gagaaaggcgaggccaggaacgaagaactacgagagctcacatccaagttcatgctccgc
cggactgctgatatcctggccaaatatcttccgccaaaatcagagtatgtccttttctgc
aacccgacatcaacccaagccaacatctatcgcaatgtgctcgcctctcccgtgttccag
tgcgccatcggcaactcagaaaacgcacttcatctcattaccatcttgaagaagctatgc
aacagtccctccttactttctccgaaaaatgcggacgaaacgcctagcgaaacaatcgca
gcgcttttatcttcgctacctccaaatcttctacgccacttctctccgtcaagcagcgca
aagatccgcgttcttgaccagttacttcataacctacgcacatctacatccgagaaaatc
gtccttgtatcaaactacacctccacgctaaacctgctagcgaatcttctttcatctctc
tctctccccttcctaaggctggacggctcaacgccggcacagaaacgacaatccctagtc
gaagatttcaaccggctccccgccgacctctgctttgcgttcctcctctccgcaaaagca
ggaggcaccggactgaaccttatcggagccagccgcctggtcctcttcgacgtggactgg
aatcccgcaacagacatacaagccatggcgcggatccaccgcgacggccagaagcgacac
tgccggatctaccgcatcctgcttaagggcagcctggaggagaagatctggcagcgccag
gtcaccaagataggactggcggacagcgtcatggagcacaaaagcagcgtcgcgcagttc
tcccgggacgagctacgggatctcttccggctcgacgaagagagccgctgccagacgcat
gagctgctgggctgcgattgcggcgggacaggacgcacggtgcagagcgcgagcagcgtc
ccacccacggatgccgaaagtaaagatccaacatcggatccgaatctatcttcctccagc
gacctctcggacgtcgaagacgatttcccagatacactcaccctcatcaaggcctcgcag
gtgaacatggaagagcaggagcggcggatacgtgcaatgcgaggcaccactcgccgtgcg
atccgcacgaccaaaatcgacgacagtgatgatgatgatgatgatgagggtgaggacccc
gtcaaaccgaaaagcaagatgcagcagtccctctcgcaatacagccacatcgaccctgct
cttctcgcctcggaagaggacggactcggtctcgcggctgcgatcgacgacgacgacgtc
cttctccccctgcttcgtgacgaggataatcgcatcgggttcattttcaagaagtccggc
caggcggaggcgaaggggaagcgagcttcgtcgccggtggtgctggagtga

DBGET integrated database retrieval system