KEGG   Aspergillus clavatus: ACLA_022180Help
Entry
ACLA_022180       CDS       T01148                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase 1, putative
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
act  Aspergillus clavatus
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ACLA_022180
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    ACLA_022180
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     ACLA_022180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1041 aa AA seqDB search
MAVPGNSAVSTSGDSVGPNSNKGAGLMRRISRGAASKLARRRQSTTHSDKRDRSSGPVIM
RRRSDSKTNAQPSRESALESSNEEDSNDALESLGIWCGSEATGLPNDLNAMVSRNAGAVA
PKVDSVIQRGTVLTKVTKKRKKQVRFFLDLDAGKVYWDVSNPAKRFYIDDIKEIRVGADA
RNYREEHLVPQDVESRWFTIVIADAERLKGRSVKTLHLIAPNDMILDLWTTTLENISQYR
INLMAGLAGSGQSEAVLKAHWQREMSRLFPQGLKPGEVESLDFSAVETVCRSLHINCSKN
MLRAQFSRADLGCKGRLSFPEFQNFVARLKERTDVKDLYRASAANAHEGLTLDDFLAFLR
DSQREDVDGDRTYWVSVFDKYVRRSKSRAPSLPEIPDGQVSRMSLEAFSAFLSSNWNGIY
ASHPPQSRFDRPLNEYFISSSHNTYLLGRQVAGASSTEAYISALSQGCRCVEIDCWDGAD
GRPIVSHGRTMTTSVLFADCITVINRYAFITCDFPLILSLEVHCNPEQQLAMVKIMKDTF
KERLVLEPLLTNSSVLPSPEELKGRILVKVKTCDETLEEMRQDPSSSLSSAGRKRSSSSP
WMRPTVPEYPLITSLPALSSSSTTAQESVGPFISQDRRSFTTTSISSATEDSDSALVSAK
RERRRRQKSKITKPLSDLGVYTRGYKWQSFASPESQRYNHVYSFAERAFESICRDAENKI
VFEKHNRRYLTRVYPSGFRLRSSNFDPLKFWRRGVQMAALNWQTYDIGMQLNQAMFAAGS
DRTGYVLKPKSLRSSTNSSDEEGKSSTGRKLVRFSVDVISAQQLPRPRSIGPEDNINPYV
EIEMFSADDRGQSFVVGEGGMNASARNGVSGIGYPHRRRTKIEQSNGYSPNFNDRFKLSL
ETKYPDLVFVRWTVWSSQDGRSTGNNNSIQLATFTAKLSSLSQGYRYLPLYDLGGDQYLF
STLFCKITKEEPVPVQRLAAEELRAERMGIFRQIGQTVFKRGSSTERSDKGSETPVSPDE
KDSSPALTPTVSAASTLSLFS
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgccaggcaactcggctgtctcgacttccggggattcggttggtccgaattcc
aacaaaggtgctgggttgatgcgccggatctcccggggcgccgccagcaaactcgcgcga
aggagacaatccacgactcacagcgacaagcgagaccgcagctcgggtcccgtcatcatg
cgcagacgcagcgacagcaagaccaacgctcagcccagccgagagagtgcgctggaatca
agcaatgaggaagatagcaacgatgccttggagtctctcggaatctggtgcggctccgaa
gcgaccggtcttcccaatgacctcaatgcgatggtctcgcggaacgcgggcgctgttgcg
cccaaggttgattcggtgatccagcgcgggaccgtgttgaccaaagtgaccaaaaagcgc
aagaagcaagtgcgcttctttctggatctcgatgcgggtaaggtctattgggacgtttcg
aatcccgcgaaacgcttctacatcgacgacatcaaggagattcgcgtcggagcggatgcg
cgcaattaccgcgaggaacacctggttccacaagatgttgaaagtcgctggtttacgatc
gtcattgccgatgcagaacggctcaagggtcggtctgtcaagactctgcacctgattgcg
cccaacgacatgatcctcgatttgtggacgacgacactcgagaatatctcccagtatcgg
attaacctcatggctggcttggctggatccggccagagtgaggctgtcctgaaagcccac
tggcaacgcgagatgtcgaggttgttccctcagggcttgaaacccggcgaagtcgagagt
ctcgacttcagtgcagttgaaaccgtgtgtcggagcttgcatatcaattgttcgaagaat
atgctgcgggctcagttctccagggccgaccttggctgcaagggccgactgagcttcccc
gagttccagaactttgttgctcgtctgaaagagcgaacagatgtgaaagacctctacaga
gcctcggctgcgaacgcccacgagggcctcactctggacgattttttagcttttctccgt
gattcacagcgggaagacgtggacggtgaccgtacctattgggtttcggtgttcgacaaa
tatgttcgaagatccaaatcgcgtgcccctagtcttccggaaatcccggatggccaggtt
tcccggatgtccctcgaagccttttctgcattcctctcctctaactggaatgggatctac
gcgtctcacccccctcaatcgcgatttgaccggccgctcaatgagtatttcatctcgagc
tctcataacacgtacctcctggggcgccaggtggccggtgcatctagcacggaagcgtac
atcagtgctttatcccagggctgccgctgcgtggagatcgattgctgggatggcgccgat
ggccggccgatcgtttcccacgggcggacaatgacaaccagtgtcctttttgcggattgc
atcactgtcattaatcgatatgcgttcatcacctgcgacttccccttgatcttgtctctt
gaagtgcactgcaatcccgagcagcagctggccatggtcaaaatcatgaaagatactttc
aaggagcgtcttgtcctagaaccactcttgaccaacagctctgtccttccgtcgcctgaa
gagctgaagggtcgcattctggttaaagtcaaaacgtgtgatgagacgctcgaggagatg
cgacaggatccgtcgagttctctttccagcgccggtcgcaagcggagctcgagctctccc
tggatgcgaccgaccgtgcctgagtaccctctgatcacgagccttcctgccctctccagc
tcctcgaccactgctcaagagagcgttgggccttttatctcacaggatagacgatcattc
actacgacaagtatcagcagtgctactgaggacagtgatagcgcgctggtatctgccaag
agggagcggagacgccgtcagaagagcaagattaccaaaccactgtccgatctcggtgtc
tacactcgtggttacaaatggcagagttttgcatctcccgagagccagcgctacaatcat
gtttactcctttgcggaacgtgcttttgagagcatctgccgtgatgcagagaacaaaatc
gttttcgagaaacataaccgacgatatctcacacgggtctatccatcgggttttcgtctg
cgatcgtccaacttcgaccctctgaagttctggcgccgcggtgtgcagatggcagctctc
aattggcagacatacgacatcggtatgcagttgaatcaagccatgtttgctgcagggagt
gaccgcactggctatgttctgaagcccaaatctctccggtcttccacaaattcatcggat
gaagagggcaaatcctccactgggcggaaattggttcggttctcagtggatgtcatctca
gcgcagcaactcccgcggccccgcagcattggacccgaagacaacatcaatccttacgtg
gagatagaaatgttcagcgcagacgaccgtggccagagttttgtcgtcggcgaaggaggc
atgaacgcctctgcgcgcaatggcgtgtcaggcatcggctatcctcatcgcagacgcacg
aagatcgagcagagcaacgggtatagcccgaatttcaacgatcgctttaagctgtcactt
gagaccaagtatcctgatctggtcttcgttcgctggactgtctggagctctcaggatggg
cgcagtaccgggaataacaacagtatccagttggccaccttcacggctaagctcagcagt
ctctcgcagggctaccgctacctgccgctgtacgatctcggcggtgaccaatatctcttt
tcgactctgttctgcaagatcaccaaagaagagccggtgcctgtacaaaggctggctgcc
gaggagcttcgcgctgagcgcatgggtatctttcgacaaatcggccagacggttttcaag
cgcggttcatccactgagagatccgataaaggcagcgagacgcctgtaagtcctgacgag
aaggacagctctccagctctgacgccgactgtttctgccgcatctactttatcactgttt
tcttaa

DBGET integrated database retrieval system