KEGG   Aspergillus clavatus: ACLA_022520Help
Entry
ACLA_022520       CDS       T01148                                 

Definition
MAP kinase SakA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
act  Aspergillus clavatus
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:act00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    ACLA_022520
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     ACLA_022520
Protein kinases [BR:act01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   ACLA_022520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 365 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYTDLQPVGMGAFGLVCSARDQLTGQPVAVKKIMKPFSTPVL
SKRTYRELKLLKHLRHENIISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSTGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIQT
ICSENTLRFVKSLPKRERQPLANKFKNADPDAVDLLERMLVFDPKKRIRATEALAHEYLS
PYHDPTDEPEAEEKFDWSFNDADLPVDTWKIMMYSEILDFHNIDQGNDASQALAEGLGQG
QQNFA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcggagttcgtgcgtgcccagatcttcggcaccacctttgagatcaccagcagatac
acagacctgcagcccgtgggaatgggggcctttggcctggtctgttctgcgagagatcaa
ttgacaggacagcccgtggctgtcaagaagattatgaagcccttcagcacccccgttttg
tccaagagaacataccgcgaacttaagctgctgaagcatttacgacatgaaaatatcatt
agtttgagcgacatcttcatttcgccgctcgaggacatctactttgtcaccgaacttctt
ggaaccgaccttcacagacttttgacttcgagaccgttggaaaagcaattcattcagtac
ttcttataccagattctgcggggattgaaatatgtccactcggccggtgtcgtccaccgt
gacctcaaacccagcaacatccttatcaacgaaaattgcgatttgaaaatttgcgacttc
ggccttgcccgtatccaggatcctcagatgaccggctatgtctcgacacgatactaccgc
gctccggaaatcatgttgacatggcaaaaatatgacgtggaggtagacatctggagcacc
ggttgtatcttcgccgagatgctcgagggaaagcccctgttccccggaaaggaccacgtc
aatcagttttccatcatcaccgagctcctcgggactccccccgatgatgtgattcagact
atctgcagcgaaaatactctgcggttcgtcaagtcactgcctaagcgtgaacgccagcct
cttgcgaacaagttcaagaacgccgaccctgacgcggttgatcttttggagcgcatgctc
gttttcgaccccaagaagagaatccgtgccacagaagcacttgcgcacgaatacctttct
ccctaccacgatcccaccgatgagcccgaggcggaagagaagttcgattggtcattcaac
gacgccgacctccccgtcgatacctggaaaatcatgatgtactcggagatcctcgacttc
cacaacatcgaccaaggcaacgatgccagccaggcccttgccgaaggcttgggacaaggc
cagcagaacttcgcctga

DBGET integrated database retrieval system