KEGG   Aspergillus clavatus: ACLA_023170Help
Entry
ACLA_023170       CDS       T01148                                 

Definition
NADH-ubiquinone oxidoreductase 19 kDa subunit, putative
Orthology
K03952  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 8
Organism
act  Aspergillus clavatus
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:act00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 159 aa AA seqDB search
MSRREPQFNQHVLVDTTPMPSDIPKVEEVGATSAPLLSASYFIGDRCKAFNDDFMKCKAE
ANGRGELECLKEGRKVTRCAASVIKDINTHCMKQFTAHWECLENNNQNLWECRKPEMALN
SCVFEKLGLKKTIPGAPEGQTPVHLRPKQLYAQFPGPQY
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggagagagccccagttcaaccaacatgtcctcgtggacaccaccccgatgccc
agcgacatccccaaggtggaggaggtgggagcgacgtccgcgccgctgctgagcgcgtcg
tactttatcggcgaccgctgcaaggcgttcaatgatgacttcatgaagtgcaaggccgag
gcgaacggccgcggagagctggagtgtctgaaggagggtcggaaggttacccgctgtgcg
gcgagtgtgatcaaggatatcaacacccactgcatgaagcagttcaccgcccactgggag
tgtctcgagaacaacaaccagaacctgtgggagtgccggaagcccgagatggcgctcaac
agctgtgtctttgagaagctgggcctcaagaagaccatccccggtgcccccgagggccag
acgcccgtacatttgcggcccaagcagctgtacgcccagttccccggtcctcagtactag

DBGET integrated database retrieval system