KEGG   Aspergillus clavatus: ACLA_024530Help
Entry
ACLA_024530       CDS       T01148                                 

Definition
sphingosine kinase (SphK), putative
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
act  Aspergillus clavatus
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:act00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 486 aa AA seqDB search
MTSLNGAAHPSITADLPDSESRLLEHDSTLTVTQSISLTLGGEALLIVGTKETQSIALYN
ILHAELSPTGLTITYANPVTKDDVSVGALQYAIPEEDKARAEAFKTRLLDLAYGNAKRYK
RIKVLINPFGGKGTAGRGYHHYAAPILAAAHCTVDVEETTHRGHATEIAERIDIDAYDAI
VCCSGDGLPYEVFNGLAKRPNAREALSKLAVAMIPGGSGNAMAWNLCGTGSVSVAALALI
KGVRTPMDLVSITQGNTRTLSFLSQSFGIIAESDLGTENIRWMGAHRFTYGFLVRLMQRT
VWPCNLAMKVEMDDKNAIKEHYRRYANSEPPRRKSGDSVDDLQGLPELKFGTVLDEVPED
WEKIPGENMGNFYAGKMAIVSKDTNFFPASLPNDGLMDVVTIDGTMSRLTSLKMMTEIPE
GGFFDMPDVKIRKVLAYRLTPREKEGYISVDGERIPFEPFQVEVHRGLGTVLSKSGHLYE
AEGPRP
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacttctctcaatggcgctgctcacccttccatcactgcggatctgccggattccgaa
tctcgattactggagcatgactcgactctgacagtcacccagtccatttccctcacgtta
gggggcgaggctcttctcattgtcggaacgaaagagactcaatccattgcgttgtacaac
atcctccatgccgaactctccccgacaggcttgacaatcacatacgccaaccctgtgacc
aaggacgatgtctcagtcggtgctcttcaatacgccatccccgaagaggacaaagctaga
gccgaagcgttcaagaccagactccttgacctagcatatggcaatgcgaaacgctacaag
cgaatcaaagttttgattaatccatttggtggaaagggtactgctggccgtggatatcat
cattacgcggcgccgattcttgctgctgcgcattgcacggtcgatgttgaggaaacgaca
catcggggccacgccacggagatcgcggaacgtatcgacatcgacgcgtacgatgcaatt
gtttgctgctctggcgatggcttaccctacgaggtgtttaacggcttggcaaagagaccc
aatgctcgcgaagcgctgtctaaactagccgtggcgatgatccctggcggctccgggaat
gcgatggcttggaatctctgcggcactggtagtgtctctgttgctgcgctagcgctcatt
aagggagtacgcactcccatggacttggtctccattacccaagggaacactcggactctg
tcgttcctgtcgcaatctttcggtattatcgcagaatccgatctgggaaccgaaaacatt
cgttggatgggcgcccaccgttttacctatggtttcttggtccgtctaatgcagcgcaca
gtctggccttgcaatctagccatgaaagtggagatggatgataagaacgccatcaaggag
cattatcgcagatatgcaaatagcgaaccgccgcggcgaaaatccggagattccgtcgat
gacttgcagggactaccagagctgaagttcggcactgtattggatgaagtcccggaggat
tgggagaagattccaggggaaaacatgggcaacttctatgcgggcaaaatggccattgtc
tccaaagatacgaatttcttcccagcttctttgcctaatgatgggttgatggatgttgtc
acgatcgatggaacaatgagtcgtctcacttcgctcaagatgatgacggagatcccagag
ggaggattcttcgacatgccggacgtcaagattcggaaagtattggcatatcgacttact
ccccgcgagaaggaagggtacatcagcgtcgatggcgagcgcataccctttgagccattc
caggttgaggtccatcggggcctgggcaccgtgctatccaagtccgggcatctctacgag
gccgagggtcctaggccatga

DBGET integrated database retrieval system