KEGG   Aspergillus clavatus: ACLA_026450Help
Entry
ACLA_026450       CDS       T01148                                 

Definition
nuclear pore complex protein (SonA), putative
Orthology
K14298  
mRNA export factor
Organism
act  Aspergillus clavatus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:act00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ACLA_026450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 363 aa AA seqDB search
MSLFGAVGAAATTAGQTNTTGDVSKDVALNSPPEDGISDLRFSPASEHLAVASWDKKVRI
YEINEQGQSEGKALFEHEAPVLSCCWSPDGTKVVGAGADKAARMLDLAANATTPVQVAAH
DAPIRCCDMIPNPAGGSPLLITGSWDKTVKYWDLRQSTPIATLECQERVYTMDVKNKLLV
VGTADRYINIINLDNPTKFYKTMQSPLKWQTRVVSCFTDATGFAVGSIEGRCAIQYVEEK
DSSSNFSFKCHRETPPNQRDINNIYSVNAISFHPVHGTFSTAGSDGTFHFWDKDAKHRLK
GYPAVGGTISSTAFNRNGNIFAYAVSYDWSKGYSANTPQLPNKVMLHPVSPEEVKPRPGT
RKR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcttcggtgccgtcggcgcagcagcgacgacagctggtcaaacaaacaccaca
ggagatgtctcgaaggatgtagctctcaattcgcctcctgaagacggaatctctgatctt
cgattctcccctgcgagtgaacatcttgccgtagcctcatgggataagaaagttcgcatc
tatgagatcaacgagcagggtcagagtgaaggaaaggcgcttttcgaacacgaagctccg
gtcctcagttgttgctggtcaccggatggaacaaaagttgtcggtgctggtgccgacaaa
gctgcacgcatgcttgaccttgcagcgaacgcgacaacccccgtccaggtcgccgctcac
gatgctcccatccgatgctgcgatatgattcctaaccctgctggaggctcgcccctgctc
atcactggttcgtgggacaagaccgtcaagtattgggatttgcgacaatcgacccctatt
gcgacactggagtgtcaggaacgtgtctacacgatggatgtcaagaacaagttgctagtg
gtcggaacagcagatcggtacatcaacatcatcaacctcgacaaccctaccaaattctac
aagaccatgcagtcccccctcaagtggcagacgcgggtagtcagctgctttacggatgcc
accgggtttgctgtgggtagtattgagggacgttgtgctattcaatatgtggaggagaaa
gactcgagttcgaacttcagcttcaagtgtcaccgcgagactcccccgaaccaacgcgac
ataaacaacatctactcggttaatgccatctccttccatcctgtccatggtaccttcagc
actgcaggtagcgacggcactttccatttctgggataaggatgccaagcaccgtctgaag
ggatacccggccgtgggcggcaccatctccagcacggccttcaaccgcaacggcaacatc
tttgcctacgcggtcagctatgactggagcaaaggatactccgcgaacacgccacagctt
cccaataaagtgatgctccacccagtatcgccagaggaagtgaagcccagacctggtaca
cggaagaggtaa

DBGET integrated database retrieval system