KEGG   Aspergillus clavatus: ACLA_026640Help
Entry
ACLA_026640       CDS       T01148                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
act  Aspergillus clavatus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:act00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 198 aa AA seqDB search
MATSAVQKFRPVVVSGPSGTGKSTLLKRLFAEYPDTFGFSVSHTTRAPRAGEEHGRDYYF
TTKEDFLDLVSKNGFIEHAQFGGNHYGTSVQAVKNIAEKSRICILDIEMEGVKQVKRTDL
NARFLFLAPPSVEELEKRLRGRGTETEDSLTKRLAQAKNELEYSAQPGSHDKIVVNDDLE
KAYVELRDWIVDGGNFGA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggccacaagcgctgtacaaaagtttcgcccagtggtagtgtcaggtccctcggggact
ggaaagtcgacactgctcaagaggcttttcgccgagtatcctgatacttttggattctct
gtgtcgcacacaacccgcgctcctcgcgcaggagaggagcatggacgcgattattatttc
accacgaaagaagatttcctggacctcgtgagcaaaaacggattcattgagcatgctcag
ttcggaggaaaccattacggtactagtgtacaggcagtgaagaacattgcggagaagagc
aggatttgcattctcgatattgagatggagggagtgaaacaagtcaagcgcactgatctc
aatgctcgattcttgtttcttgcaccgccatcagtggaggaattggagaagcggctgcgc
gggagaggaaccgagacggaggacagtttgacgaaacgtctcgcccaggcgaagaacgag
ctcgagtattcggctcagccgggttctcacgacaaaatcgtcgtcaacgatgacttggag
aaggcgtatgtggagttgagggattggattgttgacggtggtaattttggggcataa

DBGET integrated database retrieval system