KEGG   Aspergillus clavatus: ACLA_026820Help
Entry
ACLA_026820       CDS       T01148                                 

Definition
porphobilinogen synthase, putative
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
act  Aspergillus clavatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACLA_026820
Enzymes [BR:act01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ACLA_026820
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACLA_026820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 382 aa AA seqDB search
MSFSTLVSDLAFRDSHDDRNSQISHLQSHVTPRSYASTAATSVSISGDISSQLHAGYSHP
LTRSWQAERQLTKVLAHLICIQEMLIYPLFITDNPDEETPIPSLPNQYRRGLNRLVPFLK
PLVQKGLRSVILFGVPLHPSAKDALGTTADDPSGPVIQAIRLIRSRLPQLYIVTDVCLCE
YTSHGHCGILREDGTLDNAQSVDRISDVALAYAAAGAHCVAPSDMNDGRVRAIKLKLIEA
GLAHRVLLMSYSAKFSGCLYGPFRDAAGSCPSFGDRRCYQLPPGGRGLARRAIQRDIGEG
ADIIMVKPASSYLDIIRDAKELAKDMPIAAYQVSGEYAMIHAGAKAGVFDLKSMAFESTE
GILRAGAGIVVSYFVPEFLDWL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctcaactcttgtttcagaccttgcattcagggacagccacgatgatagaaac
tcccagatatcccatttacagtctcatgtcacacccagatcatatgcaagcactgctgcc
acaagtgtcagcatatctggtgatatttcaagtcaacttcatgctggctatagccatcca
ttgaccagatcatggcaagctgaaagacaactgacaaaggttctggcgcatctgatttgt
atccaggagatgttaatctatccgcttttcatcacggacaatcctgatgaggagacaccc
atcccatccttgcctaatcaatatcgtcgcggcctgaaccgccttgttcccttcctcaag
ccacttgtccaaaagggactacgctcagtcattctctttggagttccgcttcacccatcc
gcgaaggatgctctgggaaccactgcggatgatccttctggtccagtgattcaagcgatc
cgtcttatcagatcccggcttcctcagctttatattgtaacagatgtttgtctttgcgaa
tacacctctcatggccattgcggtatcttgcgggaggatggaacgcttgacaatgcccag
tctgttgatcggatttcagatgttgctctggcgtatgctgctgctggtgcgcactgtgtt
gctccttctgatatgaatgatgggagagttcgtgctatcaaactcaaattaatcgaagct
gggttggcgcaccgtgttctcctcatgtcgtacagtgcgaagttcagtggttgcctgtac
ggaccgtttcgtgatgccgctggctcttgcccctcgtttggggaccgcagatgttatcag
ctcccacccggtggtcggggtcttgcgcggcgcgccatacagcgagatataggcgaaggc
gctgatataatcatggtgaagcctgcgagcagctatctggatattatcagggatgcaaag
gagctcgcaaaggacatgccaattgcagcgtatcaggttagtggcgagtatgccatgata
catgctggtgccaaggctggagtattcgatctgaagtcaatggcatttgaaagtacagaa
gggatactgagggccggggctggaattgtcgtgagttatttcgtgccggaatttctggac
tggctttaa

DBGET integrated database retrieval system