KEGG   Aspergillus clavatus: ACLA_026900Help
Entry
ACLA_026900       CDS       T01148                                 

Definition
protein O-mannosyl transferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
act  Aspergillus clavatus
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    ACLA_026900
Enzymes [BR:act01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     ACLA_026900
Glycosyltransferases [BR:act01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   ACLA_026900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 740 aa AA seqDB search
MAEMEIASTTGFDVRSDLRRRNVNITEKTSSLAPGEDIKKKHRPESSSFASVLDHWEPII
APILLTALAVFTRMYRIGRSNIVTWDEAHFGKFGSHYLKREFYFDVHPPLGKMLVGLSGL
LAGYNGSFEFKSGEQYPEDVNFTFMRVFNAAFGVVCVPLAYYTARELGFRRATVWLISLM
VLFENSYATISRFILLDSMLLCFTFTTTMCWAKFHRLQHASFSVEWFTWLFLTGISIGCV
CSVKWVGLFCTSLVGLYTIEDLWNKFGDLNMPKTVLAKHFLYRVLGLILVPALVYLLSFY
VHFWILENSGPGDAQMSSLFQANLKGTEVGRDSPLEIAVGSRVTLKNMGYGGGLLHSHVQ
TYPEGSNQQQVTCYHHKDANNDWFIYPNRQEPEYDPQGPLSFIGDGDIIRLIHGQTGRNL
HSHTIPAPVTKSQYEVSCYGNVTIGDEKDHWAVEVVDDVASRDRSRIRTLTTAFRLRHII
LGCYLRAGNVNLPQWGFKQIETTCAKENNPRDVYTHWNIESHFNDRLPPGDPGSYKSPFL
KDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPVLNVGLRMCSWDDHIIKYYLLGNPV
VYWGSTISLGVFGLLILWHLARWQRGYNDLSQADIDHFHYSGFYPLVGWVLHYLPFIIMA
RVTYVHHYYPALYYAILTFGFCVDWLTRPMSPRVRGVLFGLLYTVVIGLFVHFQAIVFGM
EGSNQQWAHLNWLSGWRIAN
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcggagatggagatcgcgtcgactaccggattcgatgtccggtctgacttgcggcgc
cggaatgtcaatattacggagaagacaagcagtttagctcctggtgaggatatcaagaaa
aagcacagacccgagtctagttcctttgcctcagttctggatcattgggagcctataatc
gcgccaatccttctgactgcattggctgtcttcacgcgcatgtaccggatcggtcgctcg
aatatcgtgacatgggatgaagctcatttcggtaaattcggttcacactacctgaaacgc
gagttctattttgacgttcatccgccattgggcaagatgctcgttgggttatctggtctc
cttgcgggctacaatggatcctttgaatttaagtctggagagcagtatccagaagatgtc
aatttcaccttcatgcgggtcttcaatgccgccttcggtgttgtgtgtgtccctctcgcc
tactacactgcccgtgagctcggtttccgcagggccactgtctggcttatcagtctgatg
gtgctatttgagaactcgtacgcgactatctcaagattcatattacttgattcgatgctg
ctttgcttcacctttacaaccacaatgtgttgggccaagtttcatcggctgcaacatgct
agcttttcggtcgaatggttcacttggcttttcttaacgggcataagtatcggttgtgtc
tgcagcgtcaaatgggtcggccttttctgtacctctttggtgggactctatactattgaa
gacctatggaacaaatttggtgacttgaatatgccgaagacagtactagccaagcacttc
ctttatcgtgttttgggactgatcctcgtaccagctttggtatatctgctctccttctac
gtccacttctggattcttgaaaacagtgggcccggagatgcgcagatgagctctctcttc
caagccaacctaaagggtaccgaggttggaagagatagccctctcgagattgctgttggt
tctcgagtcaccctgaagaacatgggctacggtgggggactcctgcattctcatgtccag
acgtatccagaaggttccaaccagcaacaggtgacctgttatcaccataaagatgcgaac
aacgactggttcatttatcctaaccgccaggaacctgaatatgacccgcagggtccacta
tctttcattggtgatggcgatatcatccgtctcatccatgggcaaacaggccgaaatctc
cattcccacactatcccggctcccgtcaccaaatctcagtatgaagtctcatgttatggt
aatgtcaccatcggagatgagaaggatcattgggcagtcgaagttgtcgatgacgtcgca
tctcgggatcgaagtagaattcggaccttgaccactgcctttcgcctccggcatatcatt
ctgggctgctatctacgtgctggaaatgtcaatttacctcaatgggggttcaagcagatc
gagaccacgtgcgcaaaggagaacaatccacgtgatgtatacactcattggaacatagag
tctcatttcaacgacaggcttccacctggtgatccaggatcatacaagtccccgtttcta
aaagatttcatccacctgaatgttgccatgatgacatcgaacaatgctcttgtgcccgat
ccagacaaacaggatgacctcgcctcaaaattctggcaatggccagtgctcaacgttggg
ctccgcatgtgctcctgggatgatcatatcatcaaatattaccttcttggaaatccagtc
gtctactggggtagtactattagtctcggtgtctttgggcttttgatcctttggcatctt
gctcgctggcagagagggtacaatgatctaagtcaagcggatatagatcacttccactac
tcgggtttctacccccttgtcggttgggtcctgcactatctcccattcataatcatggct
cgggttacatatgttcatcattattatcctgctctttattatgccatcctcacttttggt
ttctgcgtcgactggctgacaagaccgatgagccctcgagtccgcggagtactgttcggc
cttctttacacggttgtcatcggcctgtttgtgcacttccaggccattgtgtttggcatg
gagggctctaatcaacaatgggcacatttgaattggctaagtggctggcggatcgctaat
taa

DBGET integrated database retrieval system