KEGG   Aspergillus clavatus: ACLA_028730Help
Entry
ACLA_028730       CDS       T01148                                 

Definition
MAP kinase kinase (Mkk2), putative
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
act  Aspergillus clavatus
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:act04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 506 aa AA seqDB search
MSSSPAVPLLRPPVPGNRNNSGGPRPPKLTLGIPPSPNTRPVTGNGVPTLAAPEAPKPQQ
RPSTRPALPQLRLATPMGSSSNVPREVPRLANGRPAPPPLATTGLNDSNAHSTSSSFTYL
DGKASGPASASSSNYSALSFAMGLRQPHGSTPDPSSAISSVYSDREGGVPMERDNSVNGL
LPDLDKLSLEKGRPLDVDDLDDEGWLAASEKKKIIELGSLGEGAGGAVTRCKLKDGKTVF
ALKIITTDPNPDVKKQIVRELNFNKDCASEHICRYYGAFMDKSTGTISIAMEFCEGGSLD
SIYKEVKKLGGRTGEKVLGKVAEGVLNGLTYLHSRKIIHRDIKPSNILLCRNGQVKLCDF
GVSGEFGTKGDANTFIGTSYYMAPERITGQSYTITSDVWSLGVTLLEVAQHRFPFPADGT
EMQPRAGLIDLLTYIVRQPIPKLKDEPENHIRWSDNFKYFIECCLEKEPPRRATPWRMLD
HPWMRDMKNKKVNMANFIRQVWGWQD
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctctcccgccgttcctttgctcagaccacccgtgcctggcaatcgcaacaac
agcggtggccctcgacctcccaagctcaccctaggcattcctccatcccccaacaccaga
ccggtcaccggcaatggcgtgcccaccctcgctgcccccgaagcgcccaagccgcagcaa
cggccctcgacccgtcccgctcttcctcaactccgcctcgcaacccccatgggcagcagc
tccaatgtcccgcgggaagtccctcgactggcaaacggtaggccggccccgccgccgctg
gccaccaccggtctgaacgattccaacgcccactcgacatccagcagcttcacctacctc
gacggcaaggccagcggtcctgcctcggcctcgtcctcaaattactcggctctctcgttt
gctatgggtctccgccaaccgcacggcagcaccccggatccgtcgtcggccatcagctcg
gtgtattccgaccgtgagggcggcgtgcccatggagcgggacaacagcgtcaacggactt
ctcccggatttggataagttgagtctggaaaagggcaggcccctggacgtcgacgatctg
gatgatgaaggctggttggctgctagtgagaagaagaagatcattgagctgggcagtctt
ggggagggcgcaggaggtgctgtgacacggtgcaagctcaaggatggaaagaccgttttt
gcattgaagatcatcactaccgatcccaatccggatgtgaaaaagcagattgtgcgagag
ctgaacttcaacaaggactgtgcgtctgaacacatttgccgctactatggtgcctttatg
gataagtcgaccgggaccatctccattgccatggagttttgcgagggaggtagcttggac
agtatctacaaagaggtcaagaagctaggagggcggacgggagaaaaagtcctcggcaag
gtcgcagagggggtcttgaatggtttgacatatttgcacagcagaaagattatccatcga
gatatcaaaccttccaatatcctcctatgtcgaaatggccaagtgaagctctgtgacttt
ggtgtcagcggggaattcgggaccaaaggcgacgccaataccttcatcggcacctcgtat
tatatggccccggaacgtatcacaggtcaatcctataccatcacctccgatgtgtggtcg
ctcggcgtgactttgctcgaggtagcccagcaccggttcccattccccgccgatggcaca
gagatgcagccacgagccggattgatcgatcttcttacctacattgttcgtcaacccatc
cccaagctcaaagatgagccggaaaatcatattcgctggtctgataacttcaaatacttt
attgaatgctgtcttgagaaagaacccccacgaagagccacaccctggcggatgctggac
catccctggatgcgggacatgaaaaacaaaaaggtcaacatggccaactttatccgacaa
gtgtggggctggcaagactga

DBGET integrated database retrieval system