KEGG   Aspergillus clavatus: ACLA_029190Help
Entry
ACLA_029190       CDS       T01148                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase, putative
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     ACLA_029190
    1.3.1.94  polyprenol reductase
     ACLA_029190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 323 aa AA seqDB search
MDLITKLVDTTLSITHMDAVDALRAFFIFATCLILSVSLPDTLRSRFVTYGARATSPPIK
SESLARKASDTSLVTLALDYLASLRVPHSYFLHFYVAAVLSSLFWAAQLVSRGAVFQAIA
ARVGPEHLEKSMNINQLFLCWVLMFVQGVRRLHESRIFAKPSSSRMWFVHWLLGLAFYLM
ATTAIWIEGTGTLMIHKLSLDDVQIATIPTLRTFLCLPIFLFASGIQHDCHHYLFSLKKY
TLPTHPMFRAIVCPHYTAECAIYLSLALLAAPQGEWVNKTLLSCFAFVIVNLGVTAAISK
QWYKQKFGPEAVKGKWNMVPGVF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggatctcatcaccaagctcgtggacacaacactctccattacacacatggatgccgtt
gatgctcttcgagctttcttcatcttcgcaacctgcttgatcctgtcggtcagcctgcca
gatacacttcgctcccgcttcgtcacctacggcgctcgtgcaacctcacccccgattaaa
tcggagtcccttgcgcgcaaggcttcggatacatcactcgtcacactcgctcttgactac
cttgcctctctgcgagtcccgcacagctatttcctccacttctatgtcgccgccgtgctc
tcttcgctcttttgggcggcgcagttggtttcgcgaggtgctgtcttccaggccattgca
gcgagggtcggtccggagcatctggagaagtcaatgaatatcaatcagctctttctatgc
tgggtattgatgttcgttcagggggttcggcggttgcatgaaagccgcatctttgcgaag
ccgtcttcttctcggatgtggtttgttcattggcttttaggcctcgctttttacctcatg
gccacaactgccatttggattgaggggacaggtacgctcatgattcacaagttgagcctc
gacgacgttcaaatagccactatccctacgctgcgcaccttcctctgtcttccaattttc
ttgtttgcctcggggattcagcacgactgtcatcactatctcttctctctcaagaagtat
actcttccgacccatccgatgtttcgtgcaattgtatgtccccactacacggctgaatgt
gcgatatacttgtcattggctctgttggcggcaccgcagggcgaatgggtcaacaagacc
cttttgtcgtgcttcgcgttcgtcatcgtgaatctgggcgtaaccgctgctatcagcaag
caatggtataagcaaaagttcgggcccgaggctgtgaagggaaaatggaacatggttcct
ggagttttctaa

DBGET integrated database retrieval system