KEGG   Aspergillus clavatus: ACLA_029330Help
Entry
ACLA_029330       CDS       T01148                                 

Definition
disulfide isomerase, putative
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
act  Aspergillus clavatus
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:act00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ACLA_029330
Enzymes [BR:act01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ACLA_029330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 478 aa AA seqDB search
MMQPSSALLLVASLLTALPVNADGLYTKKSPVLQVTQKNYDQLIASSNYTSIVDCASFRF
YAPWCGHCQSLKPAYEKAAKNLEGLAKVAAVNCDEDANKPLCGRMGVQGFPTLKIITPSK
KPGKPRVEDYQGARSAKAIVDAVVDKIPNHVKKATDKDLDQWLSKDEDKPRAILFTEKGT
ISALIKAVAIEFLGSIQVGQIRNKEAAAVEKFGVTQFPTLVLVPGGGKEPIKYSGDLKKQ
AIVEFLSQAAAPNLDPAPATPKAKPTKSNKSAKPAKTSTVLDDEAENLKPTESPDPKVVS
DDATESKPAQVPIAAPPIAALPTVEALETACLTPKSGTCVLALFPEPSEPNAEIPSSAKD
ALLSLSEVAHKHALRKSKLFPFYAVPAMNSGAKALRAGLGLPEDQTSIEVVAVNARRGWW
RRYDASETQDFGPAAMEAWIDAIRLGEGSKSKLPEGIVVEQKEAEKQAEKETSDHDEL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagccaagctctgcacttcttcttgttgcatcccttctgacagctttgcctgtc
aacgcggatggactgtatactaaaaagtcacctgtactgcaggtcactcagaagaactat
gaccagctcattgctagttctaactacacatcgatcgtagattgcgcctctttcagattc
tatgccccgtggtgtggccactgccagagccttaagcctgcatacgagaaagccgccaag
aacctggaggggctggccaaggttgccgctgtaaactgcgatgaggatgcgaacaaaccc
ctgtgtggtcgtatgggcgtacaaggattccccacactcaagattatcacgccttcgaag
aagcccggcaaacccagggtggaggactatcagggagctagaagcgccaaggcgatcgtc
gatgcagttgtggacaagatcccaaaccatgtaaagaaggccacggacaaggatctggat
caatggctttcgaaggacgaagacaagcctcgggcaattctgttcactgagaagggtaca
atcagcgctcttatcaaagccgtggctatcgagttcctcggctcgattcaggtcggtcag
attcgcaacaaggaggccgccgcggtggagaagttcggcgtcacacagtttcccactctg
gtcttggttcctggaggtggcaaagagcccatcaaatacagcggcgacctcaagaagcaa
gccatcgtcgagttccttagccaagcggctgcccccaacctggaccctgcccctgccaca
ccaaaagccaaacctacgaagtcgaacaaatcggccaaacccgccaaaacgtcgactgtg
ctcgacgatgaagcagagaacctgaagcccactgaatcccccgatcccaaggtcgtctcg
gatgacgcgacggaatccaagcccgcgcaggtaccaatcgcagcaccacccatcgccgca
ctccccaccgtagaggcgctggagactgcctgcctgacccccaagtctggcacctgcgtc
ctcgctcttttccccgaacccagcgaacccaacgccgagatccccagctccgcgaaagat
gcgcttcttagtctgtccgaggtcgcacacaagcacgcgctgcgcaagagcaagctcttc
cccttctacgctgtgccagccatgaacagcggcgctaaggctctgcgtgctgggcttgga
ttacccgaggaccagacctcgattgaggtcgttgctgtgaatgcgcgcaggggctggtgg
aggcgctacgatgcctcggaaactcaggactttgggcctgccgcaatggaagcatggatc
gatgctattcgactgggagagggttcgaagagcaagttgcctgagggcattgtggtcgaa
cagaaggaggctgagaagcaggctgagaaggagacatccgatcatgatgaattgtaa

DBGET integrated database retrieval system