KEGG   Aspergillus clavatus: ACLA_029690Help
Entry
ACLA_029690       CDS       T01148                                 

Definition
serine/threonine protein phosphatase PP1, putative
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
act  Aspergillus clavatus
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:act00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    ACLA_029690
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    ACLA_029690
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     ACLA_029690
Protein phosphatases and associated proteins [BR:act01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     ACLA_029690
Transcription machinery [BR:act03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     ACLA_029690
Spliceosome [BR:act03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    ACLA_029690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MADQEVDLDNIIDRLLEVRGSRPGKQVQLLESEIRYLCTKAREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLN
SMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHDM
DLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK
KQKYVYGGMSSGRPITPPRKPKKK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcaggaagtggatctggacaacatcattgatagactgctggaggtgaggggc
agccgacctggaaagcaggttcaacttctggaatcggagattcggtacctctgcactaag
gcccgggagatcttcatttctcaaccgatcctgttggagctggaagcgcccatcaagatc
tgcggtgatatccacggccaatactacgatctcctgcgtctctttgaatacggtggcttc
ccgcctgaagctaactatctcttcctcggagactatgtggaccgtggcaagcagtcgctt
gagaccatctgtctcctcctcgcgtataagatcaaataccccgaaaacttcttcatcctc
cgtggtaaccacgaatgcgcctcgatcaaccgtatctatggcttctatgacgagtgcaag
cgccggtataacatcaagctctggaagacgttcactgattgtttcaactgcttgcccatt
gccgctattattgacgagaagatcttcaccatgcacggcggtcttagccccgatctgaac
tcgatggaacagatccgtcgcgtgatgcgtccgactgatattcccgactgcggtcttctc
tgcgatctcctctggtccgatcccgataaggatatcacgggctggagcgaaaacgaccga
ggtgtatcgttcacattcggacccgatgtcgtctcccgtttccttcagaagcacgatatg
gatctgatatgccgtgcgcatcaagtggtcgaggacggttacgaattcttctcgaagaga
cagcttgtaacgctattcagtgctcccaactactgtggggagtttgacaacgctggtgcc
atgatgagtgtcgacgagagccttctttgttcgttccagatcttgaaacccgcagaaaag
aaacaaaagtacgtttacgggggcatgagctcaggcaggcccatcactcctccgcgcaaa
ccaaagaagaagtaa

DBGET integrated database retrieval system