KEGG   Aspergillus clavatus: ACLA_030130Help
Entry
ACLA_030130       CDS       T01148                                 

Definition
NADH-cytochrome b5 reductase, putative
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
act  Aspergillus clavatus
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ACLA_030130
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     ACLA_030130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 322 aa AA seqDB search
MFARQPLRFAQPLKQGFRKYSTEAPAKGKSSLAPIYISVGLAGLGVGLYRYSTASAETPV
VDRPKVFTGGEQGWVDLKLSEIENLSHNTKRLRFEFADKEAVSGLQVASALLTKFKPAEG
KPVIRPYTPVSDEDQPGYLDLVVKVYPNGPMSEHLHSMNVDQRLEFKGPIPKYPWETNKH
KHICLIAGGTGITPMYQLARQIFKNPEDQTKVTLVFGNVSEEDILLKKELQELENTHPRR
FKAFYVLDNPPKEWTGGKGYVTKELLKTVLPEPKEEDIKIFVCGPPGMYKAISGPKVSPK
DQGELTGLLAELGYNKDQVYKF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgcgccaacctctccgctttgctcagcccttgaagcagggcttccgcaagtat
tccacggaggctcccgccaagggcaagtcatctctcgctccgatctacatctcggtcggt
cttgctggtctcggtgtgggattgtatcgctacagcacagccagcgctgagacgcccgtt
gtcgatcgccccaaggttttcaccggcggagagcagggatgggttgacctcaagctgtcc
gagatcgagaacctgagccacaacaccaagagactgcgcttcgagttcgccgataaggag
gctgtctccggtctgcaggttgcctctgccctgttgaccaagttcaagcccgctgagggc
aagcctgtcatccgtccttatacccccgtgagcgatgaagatcaacccggctaccttgac
ctcgtcgtcaaggtctaccccaatggacccatgtccgagcacctccacagcatgaacgtc
gatcagcgactcgagttcaagggccccatccccaagtacccctgggagaccaacaagcac
aagcacatctgcctgattgccggtggtactggtatcacccctatgtaccagctggcccgc
cagatcttcaagaaccccgaggaccagaccaaggtcacgctggtgttcggcaacgtcagc
gaggaggatattctgctgaagaaggagctgcaggagctggagaacacccacccccgccgc
ttcaaggcattctacgttctggacaaccctcccaaggagtggaccggcggcaagggctat
gtcaccaaggagctcctgaagaccgttctgcccgagcccaaggaggaggacatcaagatc
ttcgtctgtgggcctcccggcatgtacaaggccatcagtggccccaaggtcagccccaag
gaccagggtgagttgacgggtctccttgcggagctcggatacaacaaggaccaggtgtac
aagttttag

DBGET integrated database retrieval system