KEGG   Aspergillus clavatus: ACLA_032290Help
Entry
ACLA_032290       CDS       T01148                                 

Definition
amylo-alpha-1,6-glucosidase, putative
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
act  Aspergillus clavatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACLA_032290
Enzymes [BR:act01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ACLA_032290
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     ACLA_032290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1542 aa AA seqDB search
MSSPRQVYLLPLKDDGSPDVPGGYIYLPAPTEPAYLLRFVIEGSSSICREGTLWVNIPES
GKEFDRSVYRSFRLKPDFNKNIQIDIPVTLPGSFSFYTTFSPLPEFSVDPVPTPEPTRTP
THYIDVAPRLTLHGKDLPLNALSIFSVLSKFMGKYPTDWDRHLNGISQRNYNMVHFTPLM
KRGASNSPYSIYDQLHFDEGSFPNGEADVAEMVSKMEKEYGLLSLTDVVWNHTAHNSKWL
EAHPEAGYSVETAPWLEAALELDTALLEFGRELKKHGLPTEFKFEDDLLRVMTALREKVV
SGIQLWQYYVVDVKADTRKIVEQWQAGDPTGAAASKYAHVKVNEFADLSLKQQADLIRKH
AIPTAKQVLGRFSRAVDPAFGLLILNVLRGKFDSLSSDIDNPEKTISAILDEVNLPFYEE
YNADVAEIMNQLFNRIKYVRIDDHGPKLGPVTEENPLIESYFTRLPLNDVTKKHSPKALA
LVNNGWIWNADAMRDNAGPGSKAYLRREVIVWGDCVKLRYGSSPDDNPFLWEYMAKYTRL
MAKYFAGFRIDNCHSTPLVVAEYLLDEARKVRPNLTVFAELFTGSEEADYVFVKRLGINS
LIREAMQAWSTGELSRLVHRHGGRPIGSFDVELPSAGSSHAIASADVDQKEKISHIRPSP
VQALFMDCTHDNETPAQKRDARDTLPNAALVALCASAIGSVMGYDEIYPKLVDLVHDKRV
YFSEFSESAEVKRDSVTGGIGGVKKLLNELHTMMGVEGYDETHIHHDGEYITVHRVHPKT
RKGIFLIAHTAFPGQCSNAILAPTHLVGTQAKHIGTWLLEVDASDSTKAETLADKEYLRG
LPSRIHEFEGTKAEQQGDDTVISVLDTFVPGSIALYETSIPKAEHVAGLENHLGQGADEA
FADLDLVDLNFVLYRCDAEERDLSGGQDGVYNIPNYGPLVYAGLQGWWSVLEDIIKNNAL
GHPLCDHLRQGQWALDFIVNRMEKAAKKDGYTSLEKPAKWLQEKFAAVRDLPSFLLPRYF
GIIVQVAYNAAWKRGIQLLSPEIKQGQEFVHQLGMVSVQQTGYVKSASLWPTKSVPSLAA
GLPHFAVDWARCWGRDIFISLRGLFLCTGRFDDAKEHILAFASVLKHGMIPNLLSSGKLP
RYNSRDSVWFFLQAIQDYAEMAPNGIEILNEKVARRFLPYDDTWFPFDDPRAYSQQSTVA
EVIQEVFQRHAHGMSFREYNAGPELDMQMKPEGFQIDIKVDWETGIIFGGNQNNCGTWQD
KMGESEKAGNKGVPGTPRDGAAIEITGLAYSALKWVTGLHERGLYPHGKVDLGEGTSITF
KDWAAKIKENFERCYYVPENPEDDSKYDVDPSIVNRRGIYKDLYKSGKPYEDYQLRGNFP
IAMTVSPDLFTPSKALGTLALADSVIVGPMGVATLDPSDLNYHPDYHNSEDSTNFATSKG
RNYHQGPEWVWQRGFFLRAFLHFDLVRRQTAEERTEAYQQVTRRLEGCKRALRESPWRGL
TELTNKNGAHCADSSPTQSWSAGCLLDLYYDASRHASKHSQT
NT seq 4629 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcctcggcaggtttacctgctgcctttgaaagacgatggatctcctgatgtg
cctggaggatacatctacctcccagcacccactgagcctgcctacctgcttcgcttcgtg
attgagggaagcagttccatctgcagagaaggaacgctatgggtgaacatccctgagagc
ggcaaggagtttgatcgctcggtttaccgaagctttagattgaagcccgatttcaacaag
aatatccaaatagatatccccgtgactttgcctggatctttttcgttctataccaccttt
tctccgctgcctgaattctctgttgaccctgttccaacgcccgaacccacgagaacaccc
actcactacatcgatgtcgcaccgagattgacgctccatgggaaagatctgcctctcaat
gccctctcgatattctccgtactttccaaattcatggggaaatatcccacggattgggat
agacacttgaatggcatcagtcaacgcaattacaacatggtgcatttcacgcccttgatg
aaacgcggagcttcgaattccccctacagcatttacgatcagttgcattttgacgagggc
tcattcccaaatggcgaggcagatgtggcagaaatggtctcgaagatggagaaggaatat
ggacttctatcattgaccgatgttgtctggaaccataccgcgcataacagcaagtggctg
gaggcacacccggaagccggttatagtgtggagactgccccgtggctcgaggcagccctc
gaactcgacactgctttgttggaattcggccgagagctcaagaagcacggtctccctact
gagttcaagtttgaggatgatctgttgagagtgatgaccgcactgcgagagaaggtcgtc
agtggtatacagctctggcagtactatgtcgtggacgtgaaagccgatacgagaaagatc
gtggagcagtggcaagctggcgatccaacaggcgctgcagccagcaaatatgcccatgtg
aaggtcaatgaatttgccgacttgtctttaaagcagcaagcagacctgatccgaaagcac
gcaattcctactgccaagcaggtattgggacgctttagtcgcgcagtcgaccctgcgttt
ggcttgttaattttgaatgtcctgcgcggaaagttcgactcgctgagctctgacattgac
aatcccgagaagactatatcagccatccttgatgaggtcaacctgcctttctatgaggag
tacaatgcagatgtcgcggaaatcatgaaccaacttttcaatcgtatcaaatacgtcaga
atcgatgaccatggcccgaaacttggtccggtcacagaggagaaccctctcatcgaatcc
tacttcaccagattgcctctgaacgatgtcaccaagaagcacagtcccaaagcactagct
ctcgtcaacaacggctggatctggaacgctgatgccatgcgcgataacgccggccctggt
tcgaaggcgtacctgcgtcgcgaggtgattgtctggggcgattgtgtgaaactcagatat
ggatcctcccccgacgacaatccctttctctgggaatatatggcaaagtacacccgcctc
atggccaaatatttcgccggtttccgcattgacaactgccattctacaccgttggtggtc
gcagaatacctgctggacgaagcccgcaaagttcgacccaatcttacagtctttgccgag
cttttcactggctctgaagaagccgattatgtcttcgtcaagcgtcttggcatcaattct
ctcatccgtgaggccatgcaagcatggagtactggagagttaagtcgcttggtccaccgt
catggtggtcgtcctataggaagcttcgacgttgagttgccttcggcaggcagcagtcat
gcgattgcttcagctgacgttgaccaaaaagaaaagatttctcacattcggccttcccct
gttcaagcactattcatggattgcactcatgataacgaaaccccagcgcagaaacgggat
gcacgagacacattacctaacgctgctctggttgcattgtgtgcttctgctattggaagt
gtgatgggctatgatgagatataccctaaacttgtggaccttgtccacgacaagcgagtc
tatttctctgagttctctgaatccgctgaggtgaagcgtgactctgtgacaggaggaatc
ggaggtgtcaagaaactcctgaatgagcttcacacgatgatgggagtggagggatatgat
gaaactcatattcatcatgacggagaatacataaccgtccaccgagtacatccaaagacg
cgaaagggcatcttcttgattgcgcacactgcattccctggccagtgcagcaatgctatc
ttggctccaactcatcttgttgggactcaagccaaacatattggaacctggctgttggaa
gtggatgcgagcgacagcaccaaggcggagacgctggcggacaaggaatacctgcgagga
ctgccgagtcggattcacgaattcgagggcacaaaggcagagcaacagggcgatgatacc
gtgatctccgttctcgatactttcgttccaggatcaattgctctgtacgaaacatctatt
cctaaggctgagcatgtggcaggattggaaaaccatctcggtcagggtgcagatgaagcc
ttcgcggacctcgatctggtggatctcaattttgtcctttatcgatgcgatgctgaggaa
cgggatttaagtgggggtcaagacggggtgtacaacatccccaactacggtccattggtt
tatgctggacttcagggctggtggagcgtcctggaagatatcatcaaaaacaatgcactt
ggtcatcctctctgcgatcatcttcggcaaggtcagtgggcgctcgatttcatcgtgaat
cgaatggaaaaagcggcgaagaaggacggctatacctctcttgagaagcccgcaaaatgg
ctgcaagagaaatttgcagctgtgcgcgatcttcctagtttcctgttgccaaggtacttc
gggatcattgtccaagttgcttacaacgctgcttggaaacgtggcatccagctgcttagc
cccgagatcaagcaggggcaagagttcgttcatcaactgggcatggtcagtgttcagcaa
accggttatgtcaaatctgcatccttgtggccaacaaagagtgttcccagccttgcagct
ggtcttccacatttcgctgtggattgggcgagatgttggggccgcgatatttttatctct
ctcagaggcctcttcctttgcactggtcgattcgacgacgccaaggagcatatccttgcg
tttgctagtgttctcaagcacggaatgatacctaacctcctcagtagcggtaagctgccg
cggtacaattctcgcgactctgtatggtttttcctgcaagcaatccaggactacgcagaa
atggcacccaacggcatcgagatcctgaatgagaaggttgcgaggcgctttctgccgtat
gatgacacctggtttccttttgatgatcctagagcatactcgcaacaatcgacggtcgca
gaggttatccaagaagtgttccagcgacatgcacacgggatgtcattccgggaatacaat
gcaggcccggagctcgatatgcaaatgaaacccgaaggctttcagattgacatcaaagtg
gattgggaaactggtatcatattcggcggcaatcagaacaactgtggaacctggcaagac
aagatgggagagagcgagaaagctggaaacaagggcgttcctggtacaccccgagacggt
gctgcgatcgaaatcactggtcttgcctatagtgctttgaagtgggtcaccggcctgcat
gaacggggactttaccctcacggaaaggtagacctcggcgagggcacgtccatcactttc
aaggattgggctgcaaagatcaaggagaactttgagcgctgctactatgttccagagaac
cccgaagacgacagcaagtacgacgtcgatcccagcatcgttaaccgcaggggcatttac
aaggatctctataagtcaggaaagccatacgaagactaccagcttcgtggcaatttccca
atcgccatgacagtgtctccggaccttttcactccctcgaaagcactgggtaccctggct
cttgctgactcagtgatcgttggacctatgggcgttgctacgctggacccgtccgacctg
aactaccaccccgattaccacaactctgaggattcgaccaacttcgcaacctccaagggt
agaaattaccaccaaggccctgaatgggtctggcagcggggcttcttcctccgtgctttc
ttgcattttgatcttgtccgcagacaaacggccgaggaacgaacggaggcataccagcaa
gtgacccgacgcctggagggatgcaaacgtgctttgagagagagtccatggaggggtctc
acggagcttacaaacaagaacggcgctcactgcgcggactcttcacccacacagtcatgg
tcggcaggatgcttactcgatctctattatgatgcttcccgacatgcctcgaagcattct
cagacataa

DBGET integrated database retrieval system