KEGG   Aspergillus clavatus: ACLA_033360Help
Entry
ACLA_033360       CDS       T01148                                 

Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
act  Aspergillus clavatus
Brite
Chromosome [BR:act03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    ACLA_033360
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ACLA_033360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa RP-C YscO-like
Motif
Other DBs
NCBI-GeneID: 4703176
NCBI-ProteinID: XP_001270559
UniProt: A1CJ09
AA seq 140 aa AA seqDB search
MPPKAAEKKPSTGGKAPAGKAPAEKKEAGKKTAAAASGDKKKRGKTRKETYSSYIYKVLK
QVHPDTGISTRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGEL
AKHAVSEGTKAVTKYSSSAK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaagccgccgagaagaagcctagcactggtggcaaggcccccgctggaaag
gctcccgccgagaagaaggaagctggcaagaagactgccgccgctgcctccggtgacaag
aagaagcgcggaaagaccaggaaggagacctactcctcatacatttacaaggttctcaag
caagttcaccccgacaccggtatctcgacccgtgccatgtccatcctgaactccttcgtc
aatgacatcttcgagcgtgtcgctactgaggcctcgaaactggctgcttacaacaagaaa
tctactatttcgtcgagagagatccaaacttccgttcggcttatcctccctggtgaattg
gctaagcatgccgtatcggaaggcaccaaggcagtgacaaagtactcttcttctgccaaa
tga

DBGET integrated database retrieval system