KEGG   Aspergillus clavatus: ACLA_033360Help
Entry
ACLA_033360       CDS       T01148                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
act  Aspergillus clavatus
Brite
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ACLA_033360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 140 aa AA seqDB search
MPPKAAEKKPSTGGKAPAGKAPAEKKEAGKKTAAAASGDKKKRGKTRKETYSSYIYKVLK
QVHPDTGISTRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGEL
AKHAVSEGTKAVTKYSSSAK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaagccgccgagaagaagcctagcactggtggcaaggcccccgctggaaag
gctcccgccgagaagaaggaagctggcaagaagactgccgccgctgcctccggtgacaag
aagaagcgcggaaagaccaggaaggagacctactcctcatacatttacaaggttctcaag
caagttcaccccgacaccggtatctcgacccgtgccatgtccatcctgaactccttcgtc
aatgacatcttcgagcgtgtcgctactgaggcctcgaaactggctgcttacaacaagaaa
tctactatttcgtcgagagagatccaaacttccgttcggcttatcctccctggtgaattg
gctaagcatgccgtatcggaaggcaccaaggcagtgacaaagtactcttcttctgccaaa
tga

DBGET integrated database retrieval system